KEGG   Zea mays (maize): 100283232Help
Entry
100283232         CDS       T01088                                 

Definition
(RefSeq) beta-hydroxyacyl-ACP dehydratase isoform X1
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
zma  Zea mays (maize)
Pathway
zma00061  Fatty acid biosynthesis
zma00780  Biotin metabolism
zma01100  Metabolic pathways
zma01212  Fatty acid metabolism
Module
zma_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    100283232
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    100283232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:zma01004]
    100283232
Enzymes [BR:zma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     100283232
Lipid biosynthesis proteins [BR:zma01004]
 Fatty acid synthase
  Component type
   100283232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 100283232
NCBI-ProteinID: XP_008654996
UniProt: C0P624
LinkDB All DBs
Position
8
AA seq 219 aa AA seqDB search
MDPAAMLRSPCSIVSPGSLLTAPLLPVRLAVQPRRRVPGFIAPSGRPSVARRAAAGDKFE
AETPIEKSFPPFPTVMDINQIRDILPHRFPFLLVDRVIDYKPGEYAVAIKNVTINDNFFP
GHFPERPIMPGVLMVEAMAQVGGIVMLQPEVGGSRENFFFAGIDKVRFRKPVIAGDTLIM
RMTLIKLQKRFGIAKMEGKAYVGADLVCEGEFLMATGSE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgcagccatgttgagatccccgtgctctatcgtctcgccgggctccttatta
accgccccacttctcccagtacgcctcgccgtccagccacgccgccgagtgcctggtttt
attgcgccctccggcaggccgtccgtcgcgcggcgcgccgcggccggagacaagttcgag
gccgagacgcccatagagaaaagtttccctcccttcccaactgtcatggacatcaaccag
atccgtgacatcctgccacataggttcccgtttcttctggttgacagagttattgattac
aaaccaggagaatatgctgttgcaatcaagaatgtgacaataaatgataacttcttccca
gggcatttccctgaacgacccataatgcctggtgttctcatggtcgaggcaatggcccag
gtcggaggaatagtgatgttgcagcctgaagtgggtggatctcgagagaacttctttttt
gcggggatcgataaagtgaggttccggaagcccgtgatcgctggagacaccttgataatg
agaatgactctgatcaagctgcagaagagattcggaattgcaaagatggaagggaaagct
tacgttggcgccgacctggtatgcgaaggggagttcttgatggctactggatcagaatga

DBGET integrated database retrieval system