KEGG   Zea mays (maize): 100285945Help
Entry
100285945         CDS       T01088                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
zma  Zea mays (maize)
Pathway
zma00071  Fatty acid degradation
zma00592  alpha-Linolenic acid metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01212  Fatty acid metabolism
Module
zma_M00087  beta-Oxidation
zma_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100285945
   00592 alpha-Linolenic acid metabolism
    100285945
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100285945
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100285945
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100285945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 100285945
NCBI-ProteinID: NP_001152306
UniProt: B6UC41
LinkDB All DBs
Position
8
AA seq 723 aa AA seqDB search
MAAKGRTELDVGADGVAVITIYNPPVNSLSIDVLHSLKESYEEALRRNDVKAIVVTGKGG
KFSGGFDISSFGGVQGGQTMQPKVGYIAIDILTDTVEAATKPSVAAIDGLALGGGLEVAM
ACHARIATPTAQLGLPELQLGIIPGFGGTQRLPRLVGLTKSLEMMLLSKPIKGGEAHQLG
LVDALVSPNDLVNTARQWALDIYECRRPWIKSLYKTDKLEPLGEAREILKFARAQAQKQA
ANLHHPLVCIDVIEEGIVAGPRAGLWKEATSFQELLFSDTCKSLVHVFFSQRATSKIPGA
TDLGLMPRKITKVAILGGGLMGSGIATAMVLSNYPVLLKEVNEKFLTAGINRIQANLQSR
VRKGKMTDERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDLEKYCPSHCI
LATNTSTIDLNLIGEKTKAQDRIAGAHFFSPAHVMPLLEIVRTQHTSPQVVVDLLDVGKK
IKKTPIVVGNCTGFAVNRMFFPYTQSALFYVDLGMDVYKIDRACTKFGMPMGPFRLADLV
GFGVAVATGMQYLENFPERVYKSMLLPLMMEDNRAGEATQKGFYKYEGKRKATPDPEIMK
YIEKSRSMAGVTPDPELMKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGM
GFPPYRGGVMHWADSIGAKYIHGKLEEWTKRYGGFFKPCSYLAERAAKGIPLSAPTKKVQ
ARL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaaggggaggacggagctggacgtgggcgccgacggcgtggccgtaatcacc
atctacaatccgcccgtcaactcgctctccatcgacgtcttacatagcttaaaagaaagc
tatgaagaagcacttcggagaaacgatgttaaagctattgtcgttacagggaaaggaggg
aaattttctggaggatttgatattagttcctttggtggtgttcaaggaggccaaacaatg
caaccaaaggttggctacatagcaatagatattctcacagatactgtagaagctgcgaca
aagccatcagtggcagcaattgatggtcttgctcttggtggaggtttagaagttgccatg
gcatgccatgcacggattgcaactccaacagctcaattaggtcttccagaacttcagtta
ggaattattccaggatttggaggaacacagcgactcccacgactggttggtctgacaaaa
tctttggaaatgatgctgttatctaagccaatcaagggcggtgaggcacaccaactgggc
ctggttgatgccttagtttctcctaatgatttggtgaatactgctcgtcaatgggctttg
gatatatatgaatgtaggaggccctggatcaaaagcctttataagactgacaagctagaa
cctcttggggaggctagggaaattctgaagtttgcaagagctcaagctcaaaagcaggca
gctaatcttcatcacccacttgtttgtattgatgtcattgaagaaggtatagttgcagga
ccacgggctggactctggaaggaagcaacttctttccaggaactgcttttctcagatact
tgtaaaagcttagttcatgtgttcttttctcagcgggcaacgtctaagattccaggtgct
acagacttggggttgatgcctaggaaaataactaaagttgccattctaggtggtgggctt
atgggttcaggaattgcaactgcgatggtattaagtaactatcctgtgctacttaaagaa
gtaaatgagaagttcctaactgctggaatcaacagaatccaagccaatttgcagagtcga
gtaaggaaaggaaaaatgaccgatgagcgatatgagaaggctatgtctctcgttactggt
gtccttgattatgaacgtttcaaagatgtagacctcgttatagaggcagttattgagaat
gtgaagttgaagcagcaaatattttctgacttagagaagtactgtccttcacattgcatc
cttgctactaacacatctacaattgatcttaatctgattggggagaaaacaaaggctcaa
gatcgtattgctggtgcacacttctttagtcctgcgcatgtgatgccacttctggaaata
gttcgtactcagcacacttcaccacaagttgttgttgacttgctggatgttgggaagaag
attaaaaagacaccaatagtcgtcgggaactgtactggctttgcagttaataggatgttc
tttccatacactcaatcagcactcttttatgttgatcttggtatggatgtttataagatt
gatcgtgcttgtaccaaatttggaatgcctatgggtcctttcagactggcagatctggtt
ggttttggtgtggctgtggccactggtatgcaataccttgaaaatttcccagagagggtc
tacaaatcaatgctacttcctctgatgatggaggacaatagggcaggtgaagccacccaa
aaaggattttacaagtatgagggcaagaggaaagcgactcctgatcctgaaattatgaaa
tatattgaaaaatctaggagcatggcaggagttacaccagatcctgagctgatgaagcta
agtgagaaagacatagtcgagatggtgtttttcccggtgataaatgaagcctgccgagtc
cttgatgagggtatcgccgtcaaggcttctgacctagacatcgcttcgatcttcggcatg
gggttcccaccttataggggaggtgtcatgcactgggcagattccatcggcgcaaagtac
atccatggaaagttggaggagtggacaaagcggtatgggggcttcttcaagccctgctct
tacctcgctgaaagagctgcaaaagggattcctctgagtgcaccaacaaagaaagttcag
gctcggctataa

DBGET integrated database retrieval system