KEGG   Zea mays (maize): 100383890Help
Entry
100383890         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100383890 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
zma  Zea mays (maize)
Pathway
zma03030  DNA replication
zma03410  Base excision repair
zma03420  Nucleotide excision repair
zma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100383890
   03410 Base excision repair
    100383890
   03420 Nucleotide excision repair
    100383890
   03430 Mismatch repair
    100383890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:zma03032]
    100383890
   03400 DNA repair and recombination proteins [BR:zma03400]
    100383890
Enzymes [BR:zma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100383890
    6.5.1.6  DNA ligase (ATP or NAD+)
     100383890
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100383890
DNA replication proteins [BR:zma03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100383890
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100383890
DNA repair and recombination proteins [BR:zma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100383890
   NER (nucleotide excision repair)
    Other NER factors
     100383890
   MMR (mismatch excision repair)
    Other MMR factors
     100383890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 100383890
NCBI-ProteinID: XP_008645679
UniProt: C0PJT3
LinkDB All DBs
Position
1
AA seq 909 aa AA seqDB search
MFVLTATTSTTTATSLLLRCRPLPSPKTVTLATPPAILPFCIRSRFSASASASASSVSPQ
SRATAAAAAGKSREKKPPTARAKRADAVPAAAAPGMSASGGGSAGKRTVADVLMGNARAA
ASKAKKAAPSPKKPQAKTDGAEVEPEAAAVAEKPPSPARSKRASSPAKSPKLLPDGSTSS
AKSKGPAALAQLDAAKENPPSPKRSKTLAAKSDTQPSGEGVVGLGHTDGKKGSPSPTKAK
GQASQSEEKKRAASPKKAKTTDSPKTEKNITLELKKKGSEFDPMAVAYWKPGEPVPFLFL
ARALDLISNESGRIVITEILSNVFRTVMATTPDDLLATVYLSANRIAPPHEGIELGIGDA
SVIRALAEAYGRKEEHVKKDLKELGDLGLVAKASRSSQKMMFKPKPLTIARVLSTFRTIA
KESGKDSQDKKRNHMKGLLVAATDCEPQYITRLLQSKMRIGLAEKTVQMALGQAAVYADK
NPLPPKVQSPFEEAAKIIKQAYSVLPIYDKIVPAILEVGVWKLPETCKFSIGVPVGPMLA
KATKSVSEIIDKFQGLEYTCEYKYDGERAQIHCMEDGSVEIYSRNAERNTGKYPDVVDAV
SRFRKATVKSFVLDCEIVAYDREKQKILPFQILSTRARKGVTINDIKVSVCTFGFDILYI
NGKPLLQEQLKIRREHLYNSFEEVPGVFKLATAITSNDLEEIQKFLDTAVNSSCEGLIIK
TLDKDATYEPAKRSNNWLKLKKDYMDSIGDSLDLVPIAAFYGRGKRTGVFGSFLLACYDE
QNEEYQTICNIGTGFSEQQLEERSASLRSKVIEKPKAYYRFGDTMNPDVWFEPSEVWEVK
AADLSISPVHRAANGIVDPNKGISLRFPRLLRLRDDKSPEQATTSDQVADMYRSQKINHG
YNQEDEDDD
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcctcacagccaccaccagcaccaccacggccacctcacttctcctccgatgc
cgtccactcccctcgcctaaaactgtaacacttgccacgcctcctgctatcctccccttc
tgcatccgctcccgcttctccgcctccgcctccgcctctgcatcctccgtctctccccaa
agccgtgcgaccgcggcagccgctgcaggcaaatccagggagaagaagccgccgaccgcg
agggcgaagcgggccgacgcagtacctgcagcggcggcgcctggaatgtcggcctccggt
ggcggctccgctgggaagcgcacggtggcggacgtgctgatggggaacgcacgggccgcc
gccagcaaggcgaagaaagcagcgccgtctccgaagaagccgcaggcgaagaccgacggc
gcagaggtcgaaccggaggctgcagcggtggcggagaaaccgccttcgccggcgaggtcc
aagcgggcgtcgtccccagcgaagtcccccaaattgctgcctgatgggtctacctcgtcg
gctaagtccaagggtccagccgcgctcgctcaattggatgcggcgaaggagaatcccccg
tcgccaaagaggtccaaaaccctagccgctaaatccgacacccagccttctggtgaaggt
gttgttgggcttgggcacaccgatgggaagaaggggtcaccctccccgaccaaggctaaa
ggccaagcttcccaatcagaggagaagaagcgggccgcttcacccaagaaggcgaaaacc
acagattccccgaagacagagaagaatatcaccctagagctaaagaagaaaggcagtgag
tttgacccaatggctgttgcctattggaagcctggtgaacccgtgccattcctgtttctg
gctcgcgcacttgatctcatctccaacgagagtggccgtattgttattacagaaatccta
tcaaatgtgtttcgtacagtgatggcaacaacaccggatgatctccttgcaactgtatac
ctctcagccaaccggattgcgccacctcatgaggggattgagcttgggattggggatgca
tcagtcatccgtgcacttgcagaggcatatggacgcaaagaggagcatgttaagaaggac
ctcaaggaattgggtgatttggggcttgtggcaaaagcaagcaggtcatcacagaagatg
atgtttaagccaaaaccactgacaatagctcgtgtgcttagcactttccggacaatcgca
aaggaatcaggcaaagacagtcaagataaaaaaagaaaccatatgaagggacttcttgtt
gctgcaactgactgtgaaccccagtacatcacacgccttcttcagtcaaagatgaggatt
gggctagcagagaaaactgtccaaatggcgctagggcaagctgccgtatatgctgacaaa
aatcctttgccaccaaaagttcaatcacctttcgaagaggctgcaaaaataattaaacaa
gcatattcggttcttccgatatatgataaaattgtcccagcgatactcgaagtaggagtt
tggaagcttccagagacatgcaaattttccataggtgtccctgttggccctatgttagca
aaagcaacaaaatctgtctcagagatcatcgacaagtttcagggtcttgaatacacttgc
gagtacaagtatgatggtgaaagggctcagatacattgcatggaggatggttcagtagag
atttatagtcgcaatgctgaaagaaacaccggaaagtatccagatgttgttgatgcagtt
tctagattccgtaaggctacagtcaaatcatttgtcttggactgtgaaattgttgcctat
gatcgtgaaaaacagaaaattttgccttttcagatacttagcacaagggctcgcaagggt
gtcaccataaatgacatcaaagtttcagtctgtacttttggcttcgatattctttacata
aacgggaaacctcttctccaggaacaactcaaaattcgtcgagagcatctttacaactcc
ttcgaagaagtgccaggtgtttttaaattggctactgcaattacatcaaatgacctggag
gagatacagaaatttcttgacacagctgtcaactcgagttgtgaagggttgattatcaag
acattggataaagacgcaacatatgagccagcaaaacgttcaaacaattggttgaaactg
aagaaggattacatggatagcattggagactctttggacttggtacctattgctgccttc
tacggtagaggaaaacgaacaggtgtctttggatcattcctcctcgcatgctatgatgag
cagaacgaagaatatcaaacaatatgcaacataggtactggattttctgagcaacagctt
gaagaacgttctgcgagccttcgaagtaaagtgatagaaaaaccaaaggcatactataga
tttggcgacacaatgaaccccgatgtgtggtttgagccatcagaggtctgggaggtcaaa
gctgccgatctgagcataagccctgtacatcgtgctgccaatggtatagtcgatccaaat
aagggtatctctctaagattccctcgcctattgagattacgtgacgataaaagcccagaa
caagccaccacgtctgaccaagtcgctgacatgtaccggtctcaaaagatcaaccacggt
tataaccaggaggatgaggacgatgactga

DBGET integrated database retrieval system