KEGG   Zea mays (maize): 100501386Help
Entry
100501386         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100501386
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
zma  Zea mays (maize)
Pathway
zma00220  Arginine biosynthesis
zma00250  Alanine, aspartate and glutamate metabolism
zma00260  Glycine, serine and threonine metabolism
zma00630  Glyoxylate and dicarboxylate metabolism
zma00710  Carbon fixation in photosynthetic organisms
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
zma01210  2-Oxocarboxylic acid metabolism
zma01230  Biosynthesis of amino acids
Module
zma_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
zma_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100501386
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100501386
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100501386
   00260 Glycine, serine and threonine metabolism
    100501386
   00220 Arginine biosynthesis
    100501386
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zma01007]
    100501386
Enzymes [BR:zma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     100501386
    2.6.1.4  glycine transaminase
     100501386
    2.6.1.44  alanine---glyoxylate transaminase
     100501386
Amino acid related enzymes [BR:zma01007]
 Aminotransferase (transaminase)
  Class I
   100501386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100501386
NCBI-ProteinID: NP_001183048
UniProt: C4J2Z0
LinkDB All DBs
Position
2
AA seq 479 aa AA seqDB search
MARRRPMDYEELNEKVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFP
RQVVALCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAYSDARGIPGIRKEVADF
IHKRDGYPSDPELIYLTDGASKGVMQMLNAIIRNERDGILVPVPQYPLYSAIISLFGGSL
VPYYLEEEANWNLDFANIRQAVAEARSKGITVRATVIINPGNPTGQCLSEANIRELVRYC
YHENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPISREVQLVSFHTVSKGYWGECGQ
RGGYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNPPKPGDISYPKFTAESKSI
LESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEAAKRAGKAADVFYCLK
LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKFNDSFMEQYEGYSRM
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaggaggccgatggactacgaggagctgaacgagaaagtcaagaaggcgcag
tacgcggtgcgcggggagctgtacctccgcgcctccgagctccagaaggagggcaagaag
atcatcttcaccaacgtcggcaacccgcacgccctcggccagaagccgctcaccttcccg
cgccaggtggtggcgctgtgccaggctccgttcctcctcgatgaccccaatgtcggcctc
atgttcccgcccgatgccatcgtgcgggccaagcgctatctcgccatggcgccgggaggt
ctaggtgcgtacagtgatgcccgtggtatccccggaatcaggaaggaagttgctgacttc
atccacaagcgtgatggatatccgagtgatccagaactcatttacctcacagacggcgcc
agcaaaggtgtgatgcaaatgctgaatgccatcattagaaacgagagggatgggatcttg
gttcctgttcctcagtacccactttattctgctatcatttccctctttggtgggtctctg
gtcccatactacttggaagaagaggctaactggaaccttgactttgcaaacatccgacaa
gcagtggccgaggcacgttcgaagggaatcactgttcgagcgacggtgattataaatcca
ggaaatcccactggccagtgccttagtgaagcaaatataagggaacttgtgcgatattgc
taccatgaaaacttagttctgcttgcagacgaagtgtatcagcagaacgtttatcaagat
gagcgcccatttataagcgcaagaaaggttatgttcgacatgggtccgccaataagcagg
gaggttcagcttgtttctttccacactgtgtccaaagggtactggggagagtgtggacaa
cgtggtggatacttcgaaatgacaaatcttcctccaaagacagtagatgagatatacaag
gttgcatcaatagtactgagtccgaatgttcccgggcaaatctttatgggagtgatggtt
aaccctcctaaacctggagatatctcatacccgaagttcactgccgaaagcaagtccatc
ctcgaatctttgaggaggagagcgcgcatgatgacagacggtttcaacagctgccgaaat
gtggtgtgcaatttcacagaaggagctatgtactctttcccccaaatacagctgccagca
agagccatcgaggcggcaaagagagccggcaaagcagcagacgttttctactgcctcaag
ctcctggaggcaacggggatttccactgttccgggatctggttttgggcagaaggaaggg
gtgttccaccttcggacaactatccttccagccgaggaagacttccctaccatcatgtcg
agcttcaagaagttcaacgactcattcatggagcaatacgagggctactccaggatgtga

DBGET integrated database retrieval system