KEGG   Zea mays (maize): 103629642Help
Entry
103629642         CDS       T01088                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700 isoform X1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
zma  Zea mays (maize)
Pathway
zma00052  Galactose metabolism
zma00500  Starch and sucrose metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103629642
   00500 Starch and sucrose metabolism
    103629642
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103629642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103629642
NCBI-ProteinID: XP_008648951
LinkDB All DBs
Position
6
AA seq 885 aa AA seqDB search
MAWPWSPPPRQTARFVVVVVVAVVLLFAAAPWPRAAAQAGYHVVSVSGTGGQLSARLELT
GAGQKAELGPDVRRLSLTASLETDSRLHVRITDADHRRWEVPQSVIPREAPRDDVPLEAS
TGASPPHSRVLSAATSDLAFTLHASPFRFTVSRRSSGDALFDTSAALVFKDRYLELTTAL
PPEGGASLYGLGEHTKRTFRLQRNDTFTMWNADIPAANADVNLYGSHPFYLDVRHAGAAH
GVLLLNSNGMDVEYGGSYLTYKVIGGVLDLYFFAGPSPLDVVDQYTQLIGRPAPMPYWSF
GFHQCRYGYKNLADLEGVVAGYAKARIPLEVMWTDIDYMDAFKDFTLDPVNFPAGPMRQF
VDRLHRNGQKYVVIIDPGISVNETYGTYVRGMQQDVFLKRNGTNYLGKVWPGYVYFPDFL
NPRAAEFWAREIALFRRTLPVDGLWIDMNEVSNFVDPAPLNALDDPPYRINNSGVHRPIN
NKTTPASAVHYGGVRDYDAHNLYGFLEARATHGALLADTGRRPFVLSRSTFVGSGRYTAH
WTGDNAATWDDLRYSINTMLSFGLFGIPMVGADICGFGGNTTEELCSRWIQLGAFYPFAR
DHSAIGTVRRELYLWELVARSARKALGLRYRLLPYMYTLMYEAHTTGAPIARPLFFSYPK
DEATYGVDRQFLLGRGVLVSPVLEPGATTVEAYFPAGRWFSLFDHEVVVASATGKHVTLP
GPADTVNVHVAGGNILPLQLPELTTSRARQTAFHLLVALAEDGSASGELFLDGGDLPEMA
GPRGEWSLVRFSCTQGRDGVKLMSHVVHDAYGPSRKLVIGKVMFLGLPSLAPPGEFAVYV
NGVKMANSTGATLGYQRRGALGAAQVEGLSLVVVEEFELKVVTSS
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggccgtggtcaccgccgccgcggcaaaccgcgcgcttcgtcgtcgtcgtcgtc
gtcgccgtcgttcttctcttcgctgctgccccgtggccccgtgcggccgcccaggccggg
taccacgtcgtgtcggtgtcagggacggggggccaactgtcggcgcggctggagctcacc
ggcgccggccagaaggcagagctcgggcccgacgttcgcaggctcagcctcaccgcgagc
cttgagacggacagccggttgcacgttcgcatcaccgacgcggatcaccggagatgggag
gtccctcagagcgtcatcccccgcgaggcgccgcgggacgacgtgcccctggaagcgagc
acgggagcctcgccgccgcacagccgcgtcctctccgcggcgacctccgacctggccttc
accctccacgcctccccgttccgcttcaccgtgtcccgccgctccagcggcgacgccctc
ttcgacacctccgcggcgctggtcttcaaggacaggtacctggagctgaccacggcgctg
ccgccggagggcggggcgtcgctgtacgggctaggcgagcacaccaagcgcacgttccgg
ctgcagcgcaacgacacgttcacgatgtggaacgccgacatcccggccgccaacgcggac
gtcaacctgtacggctcccacccgttctacctcgacgtgcgccacgccggcgccgcgcac
ggcgtgctcctgctcaacagcaacggcatggacgtcgagtacggcggctcctacctcacc
tacaaggtcatcggcggcgtgctcgacctgtacttcttcgccggcccctccccgctcgac
gtcgtcgaccagtacacccagctcatcggccgtccggcccccatgccgtactggtctttc
gggttccaccagtgcaggtacgggtacaagaacctggctgacctggagggcgtggtggcc
gggtacgccaaggccaggatcccgctagaggtgatgtggacggacatcgactacatggac
gcgttcaaggacttcacgctggatccggtgaacttcccggccggcccgatgcggcagttc
gtcgaccgcctccaccggaacggccagaaatacgtcgtcattatagacccagggatcagc
gtgaacgagacatacgggacgtacgtgcgagggatgcagcaggacgtgttcctgaagcgg
aacggcaccaactacctcggcaaggtgtggcccgggtacgtctacttcccggacttcctc
aacccgcgcgccgccgagttctgggcgcgcgagatcgccctgttccggcggacgctcccc
gtcgacggcctctggatcgacatgaacgaggtctccaacttcgtcgacccggcgcccctc
aacgcgctggacgacccgccgtaccgcatcaacaactccggcgtgcaccgccccatcaac
aacaagaccacgccggcgtccgcggtgcactacggcggcgtgcgcgactacgacgcacac
aacctctacggcttcctggaggcgcgagccacgcacggcgcgctgctcgccgacaccggc
cgccggcccttcgtgctcagccggtccacgttcgtggggtccggccggtacaccgcgcac
tggaccggagacaacgccgccacgtgggacgacctccgctactccatcaacaccatgctc
agcttcggcctcttcggcatccccatggtcggcgctgacatctgcggcttcggcggcaac
acaaccgaggagctctgcagccgctggatccagcttggcgcgttctacccgttcgcaagg
gaccattcggcgatcggcacggtccggcgcgagctgtacctgtgggagctggtggcgcgg
tcggcgaggaaggcgctcgggctgcgctaccggctgcttccgtacatgtacacgctgatg
tacgaggcgcacaccacgggagcgcccatcgcgcggccgctcttcttctcctaccccaag
gacgaggccacgtatggcgtggaccggcagttcctgctggggcgcggcgtgctcgtgtcg
ccggtgctcgagcccggtgccaccaccgtcgaagcctacttcccggccgggcggtggttc
agcctctttgaccacgaggtcgtcgtcgcctcggcgacgggcaagcacgtcaccctcccg
gggcccgcggacacggtcaacgtacacgtggccggcggcaacatcctgccgctacagctg
ccggagctgacgacgtcgcgcgcgcgccagaccgcgttccacctcctggtcgcgctcgcc
gaggacggatccgcatccggggagctgttcctcgacggcggcgacttgccggagatggcc
gggccgcggggcgagtggagtctggtgcggttcagctgcacgcaggggcgcgacggggtt
aagctcatgtcgcacgtggtgcacgacgcgtacgggccgagccggaagctggtcatcggc
aaggtgatgttcctgggactgccctcgctggcgccaccgggagagttcgccgtgtatgtc
aacggcgttaagatggccaactcgactggcgcgacgctagggtatcaaaggcgcggagca
ctcggcgccgctcaagtggaggggttgtcgctggtcgtcgtcgaggagttcgagctcaag
gtggtcacgtcgtcataa

DBGET integrated database retrieval system