KEGG   Zea mays (maize): 103636824Help
Entry
103636824         CDS       T01088                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
zma  Zea mays (maize)
Pathway
zma00020  Citrate cycle (TCA cycle)
zma00190  Oxidative phosphorylation
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103636824
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103636824
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103636824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Succ_DH_flav_C FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 103636824
NCBI-ProteinID: XP_020398222
LinkDB All DBs
Position
8
AA seq 116 aa AA seqDB search
MAAGEAAYASVHGANRLGANSLLDIVVFGRACANRVADISKPSEKQKPLEKDAGEKTIAW
LDKLRNANGSLPTSEIRLNMQRVMQNNAVVFRTQETLEEGIAGALCVVPFTTIMST
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggctgctggtgaagcagcctatgcatctgtccatggtgcaaataggctaggcgcaaat
tcacttcttgacatagttgtttttggcagagcttgtgcaaacagggtagcagatatttct
aaaccaagtgagaagcagaaacctctggaaaaagatgctggagagaagaccatagcctgg
ttggacaagctgaggaatgcgaatgggtcattgccaacttccgagatccgtctcaacatg
caacgtgttatgcaaaataatgctgttgtgttccgtacacaagaaacacttgaagaaggt
attgctggtgctctttgtgtagttccttttactactattatgagcacttga

DBGET integrated database retrieval system