KEGG   Zea mays (maize): 103646607Help
Entry
103646607         CDS       T01088                                 

Definition
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] reductase 4-like
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
zma  Zea mays (maize)
Pathway
zma00061  Fatty acid biosynthesis
zma00780  Biotin metabolism
zma01100  Metabolic pathways
zma01212  Fatty acid metabolism
Module
zma_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103646607
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    103646607
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    103646607
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:zma01004]
    103646607
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     103646607
Lipid biosynthesis proteins [BR:zma01004]
 Fatty acid synthase
  Component type
   103646607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Myco_arth_vir_N Eno-Rase_NADH_b
Motif
Other DBs
NCBI-GeneID: 103646607
NCBI-ProteinID: NP_001314840
LinkDB All DBs
Position
2
AA seq 315 aa AA seqDB search
MAAAAAAAAAVSSPIAPRAVAAAASRRGFVTFGGGAARSSPTLRSGRGFSGVQTHVAAVE
QAVVKDATKLEAPVVVVTGASRGIGKATALALGKAGCKVLVNYARSSKEAEEVSKEIEAS
GGEAITFGGDVSKEADVESMMKAALDKWGTIDVLVNNAGITRDTLLMRMKKSQWQDVIDL
NLTGVCLCTQAATKVMMKKKKGKIINIASVVGLTGNVGQANYSAAKAGVIGFTKTVAREY
ASRNINVNAIAPGFIASDMTAELGEELEKKILSTIPLGRYGQPEEVAGLVEFLALSPAAS
YMTGQVLTIDGGMVM
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgctgccgcagcagcagcagcagtttcctccccgattgctccacgcgctgtg
gccgccgcggcctcccgccgggggttcgtcacgtttggtggaggcgccgcccgctcctcg
cccacgctgcggtccggccgcgggttctctggtgtgcaaacccatgttgccgctgttgaa
caagcagttgtaaaagatgctacgaagctggaagctccagttgttgttgttacaggtgcc
tctagagggattggaaaggcaactgctctagcccttggaaaagcaggatgcaaggttctg
gtaaattatgctcggtcttcgaaagaggctgaagaggtctccaaagagattgaagcatct
ggtggtgaggctatcacctttggaggagatgtttcaaaagaagctgatgtagagtctatg
atgaaagcagctctagataaatggggaacgatagatgtgctggtaaataatgcaggaatt
acacgagacacattattgatgaggatgaagaaatctcagtggcaagatgtaattgatctg
aatcttacaggcgtctgcctgtgtacacaggctgcaacaaaagtaatgatgaagaagaaa
aaggggaaaattatcaacattgcatccgtcgttggccttactggcaatgttggccaagct
aattatagtgcagccaaggctggggtgattggtttcacgaaaacagttgccagggagtat
gcaagcagaaatatcaatgtgaatgctattgcaccagggtttattgcatctgatatgact
gccgaacttggagaagagcttgagaagaaaatcttgtcaaccattccattagggagatat
ggccaaccagaggaagttgcagggttagtcgagttcctggcccttagccctgcagctagc
tatatgaccggacaggtgcttacaattgacggagggatggtaatgtaa

DBGET integrated database retrieval system