KEGG   Zea mays (maize): 103651223Help
Entry
103651223         CDS       T01088                                 

Definition
(RefSeq) hexokinase-6
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma00051  Fructose and mannose metabolism
zma00052  Galactose metabolism
zma00500  Starch and sucrose metabolism
zma00520  Amino sugar and nucleotide sugar metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
Module
zma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103651223
   00051 Fructose and mannose metabolism
    103651223
   00052 Galactose metabolism
    103651223
   00500 Starch and sucrose metabolism
    103651223
   00520 Amino sugar and nucleotide sugar metabolism
    103651223
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103651223
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zma04131]
    103651223
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103651223
Membrane trafficking [BR:zma04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103651223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Myb_DNA-bind_7 Sir1 FTZ
Motif
Other DBs
NCBI-GeneID: 103651223
NCBI-ProteinID: XP_008675068
UniProt: A0A1D6NCX2
LinkDB All DBs
Position
3
AA seq 506 aa AA seqDB search
MAKGGAVVGTAVVVCAAAAAAVGVAVVLSRRRSRRREAEDERKRKAAAVIEEVEQRLSTP
TALLRGIADAMVEEMERGLRAEPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIR
VQLGGRDRRVVKQQYEEVSIPPHLMVGTSTELFDFIAAELEKFVRTEGEDFHLPDSKQRE
LGFTFSFPVHQTSISSGTLIKWTKGFCINGTVGEDVVAELSRAMERQGLDMKVAALVNDT
VGTLAGGRYADNDVVAAVILGTGTNAAYVEHANVIPKWTGLLPRSGNMVINMEWGNFRSD
KLPRSEYDKSLDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPPKLEQ
LFILRTPDMSAMHHDTSHDLKHLGAKLKDILGVPDTSLEARYITLHVCDLVAERGARLAA
AGIYGILKKLGKDKLLGDFSQQRTVVAIDGGLYEHYKKFSACLEATLTDLLGEEVASSVV
VKLANDGSGIGAALLAASHSQYAEAA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagggcggtgcggtcgtggggacggctgtggtggtgtgcgccgcggctgccgcg
gcggtgggggtagcggtggtgctgtcgcgcaggaggagtcggcggcgggaggcggaggac
gagaggaagaggaaggcggccgcggtaatcgaggaggtggagcagcggctctccacgccc
accgcgctgctccggggcatcgcggacgccatggtcgaggagatggagcgcggccttcgc
gctgagccccacgcgccgctcaagatgctcatcagctacgtcgacaacctcccaaccggg
gatgaacatggtctgttttatgcactggaccttggcgggaccaactttcgtgtcatccgg
gtccaacttggcggaagggacagacgtgtcgtgaagcaacagtatgaagaggtctccatt
ccgcctcatcttatggttggaacttctacggaactatttgatttcattgctgctgagttg
gaaaaatttgtgcggactgaaggagaagatttccacctaccagatagcaagcagagggaa
ctgggtttcaccttttctttcccagtgcaccaaacatctatatcatcggggactctaatt
aagtggaccaaaggattttgcatcaatggcacggttggagaagatgttgtggctgaattg
agtagggccatggaaaggcagggtcttgatatgaaagttgcagctctggttaatgatact
gtaggcacattggctggtgggagatatgctgataatgatgttgttgctgctgtaatattg
ggcactggcacaaatgcagcttatgtggaacatgcaaatgtgattcctaaatggaccggg
ctgctacctagatcagggaacatggtaatcaacatggagtggggaaacttcagatcagat
aaacttccaaggtcggagtatgataaatccttagacttcgaaagtttgaaccctggtgag
cagatatatgaaaagatgatttctggaatgtatcttggagaaattgtccggaggatcctg
ctgaaactggctcatgatgcttcattgtttggggatgttgttcctccgaaactggaacag
ctatttatactgaggacgccagatatgtcagccatgcaccatgacacctcacatgatctc
aaacacctgggagctaagctgaaggacattcttggggttcctgatacttctctggaagca
agatacatcactcttcatgtgtgcgaccttgtcgcagagagaggtgcacgcctggctgct
gctggtatatatggtattctgaagaagctgggtaaagacaaattgctaggtgactttagc
caacaaaggactgtagttgctattgacggtggcctatacgagcactacaagaagttcagt
gcctgcctagaggcgacgctcacagacctgctcggcgaggaggttgcctcatcggttgtt
gtcaagttggccaacgacggctcaggaattggagctgcacttcttgctgcctcgcactcc
cagtatgctgaagctgcatag

DBGET integrated database retrieval system