KEGG   Zea mays (maize): 103651343Help
Entry
103651343         CDS       T01088                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
zma  Zea mays (maize)
Pathway
zma03030  DNA replication
zma03410  Base excision repair
zma03420  Nucleotide excision repair
zma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103651343
   03410 Base excision repair
    103651343
   03420 Nucleotide excision repair
    103651343
   03430 Mismatch repair
    103651343
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:zma03032]
    103651343
   03400 DNA repair and recombination proteins [BR:zma03400]
    103651343
Enzymes [BR:zma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103651343
    6.5.1.6  DNA ligase (ATP or NAD+)
     103651343
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103651343
DNA replication proteins [BR:zma03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103651343
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103651343
DNA repair and recombination proteins [BR:zma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103651343
   NER (nucleotide excision repair)
    Other NER factors
     103651343
   MMR (mismatch excision repair)
    Other MMR factors
     103651343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 UBA_4 RMMBL
Motif
Other DBs
NCBI-GeneID: 103651343
NCBI-ProteinID: XP_008675179
UniProt: A0A1D6NFC7
LinkDB All DBs
Position
3
AA seq 1397 aa AA seqDB search
MASLLSSPDDSKSLSVTTSSLFLSSIASLPSSHAFSIFTSASTPLPPVPVSVPPAALIPG
SRFLVDAFRHAGNFSVAYFLSHFHSDHYSGLGPSWRRGLVFCSAPTARLVSSVLSVPPQL
VVSLDIGVRITVDGWGVTAVDANHCPGAVQFLFASPGPRAERYVHTGDFRYTESMTRDPN
LLEFVRADAVFLDTTYCNPKFTFPSQEDSVDYIVNAIKRVKEESSVSGERVLCLIATYAV
GKEKILLEVAQRCGCSIHVDSRKMKILTLLGFGGKNSVFTEDATGTDVHVLGWNLLGETS
PYFQPNFVKLKEIMMERGYAKAVGFVPTGWMYETKKEGFAVRVKDSLEIHLVPYSEHSSY
NELRDYVKFLHPKSVIPTAGVDAGKLDSKEAVALQKHFAGLVDETANKQEFLMAFHRRSI
DATRSCKDVVVNCSSQLDGEDAALLPAISSASEQQDKLMENTMQETLKELSDFLPSWVSQ
EQITDLLMSSEGDVVKAASIFFERERDFFEEANVSCNGTPKTEKNHSSNHGSSADVSSQQ
ESSLFSQKPVEYSAKLVNLSPMRMKPNTPKKVNKRGSSNTNKPKKKGRLTSSTESGGRKQ
STITNYFIRATEAAFKRCRPERVTVEAHQNNVENSDQLADTEKTQDQIVDQLLQIVDGSM
SREYAVYLLEKANGDVAVAVDIFYSSSEGNNVIEVDKNIMLQNAQGETADNCSETDMASG
YSQATPKMSNLHVGTSLAHGDSANTSLLIEKYLPIEHACWIAGQPAPYLHLARTFDLVEK
EKGKIKTIAIFCNMFRSLLALSPDDVLPAVYLCTNKISPDHENMELNIGGSLVVTTLEES
LGTSRSKIHEMYKTYGDLGTVAQECRQNQTLIAPPRSLSICDVYSTLRKLSAISGSGSAG
RRKNLVLHLIRSCRETEMKFLVRTLVRNLRIGAMMKTILPALAHAVVFDRNCAADPAVSL
EGIKSQLQSLSTEVAEAYNVTPNLDLLIPSLLREGTAFSASSLAMVPGTPIPPMLARITN
GLTQSLKAFHGRSFTCEYKYDGQRAQIHKALDGSVRIFSRQMKESTSRFPDLVNMIKELC
KPEVSSFILDAEVVGINRKKGNELMSFQELSSRERGNKHSSISIENIKVDICVFVFDIMF
HDGERLLDCPLRQRRKYIHDLFHEKPGYFELAQQLNIEACEASPDNSSTLARMDTFFRNA
CQSSCEGIMLKTLDVDAGYSASKRCDSWLKVKRDYVQGLGDSLDLVPIGAWYGNGRKAGW
YSPFLMACYNPETEEFQSVCRVMSGFSDEFYKEMKEFYSGERILPKKPVYYKTDEQPELW
FTAEQIWEIRGADLTLSPVHHAAIGLVHPSRGISVRMPRYIRSVPDRSPEDCGTAADIAS
MFKAQTRKMDVSSEGQE
NT seq 4194 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctcctctcctcccccgacgattccaagtcgctgtccgtcaccacctcatcg
ctcttcctctcctccatcgcctctctcccctcttcccatgccttctccatcttcacctcc
gcctccacgcctcttccccctgtcccggtctctgtgcctcccgccgcactcatcccgggc
tcccgcttccttgtcgatgccttccgccatgccggaaacttctctgtcgcctacttcctc
tcgcacttccactccgaccactacagtggcctcggcccttcctggcgccgcggccttgta
ttctgctccgcgccaaccgcacgcctcgtctcatccgtgctctctgtcccgcctcaactt
gtcgtctccctcgatatcggtgtccgtatcaccgttgatgggtggggcgtcaccgccgtg
gacgccaatcattgtcccggtgccgttcagttcctcttcgcctctcctgggccgagagcc
gagagatatgtgcacaccggtgactttcgttacacagagtctatgacgcgtgatcctaac
ttgctggagttcgtccgtgctgatgcggtgtttctggacaccacatactgcaaccccaag
tttacattcccttcgcaagaggattctgtggattacatagtgaatgcaatcaaacgtgtg
aaagaggagagttcagtatcaggagagcgtgtgctatgtctgatcgccacctatgctgtc
ggcaaggagaagattttgctggaggtcgcacagcgctgtgggtgttcaatccatgtggac
agtaggaagatgaagattttgacactgttggggttcggtgggaagaatagcgtttttact
gaggacgcaacagggacggatgtgcatgttcttgggtggaatttgttaggggagacttcg
ccctacttccagccgaattttgtgaaattgaaggagatcatgatggagagagggtatgct
aaggctgttgggtttgtaccaactgggtggatgtatgaaaccaagaaggaaggttttgct
gttagggtgaaagattcactcgaaatccatcttgttccttatagtgagcactcaagttac
aatgagttgcgcgactatgttaagtttttgcacccaaagagtgtgatccctactgccgga
gtggatgctgggaagctcgatagtaaggaggcagttgctctgcagaagcattttgctggg
ttggttgatgagacagcaaacaaacaggagttcttgatggcattccatcgtaggtcaata
gatgctactcgtagctgcaaagatgtggttgttaattgctcgagccagcttgatggggag
gatgctgctttgttaccagcaatctcttctgcttctgaacaacaggataaactgatggag
aatactatgcaggaaacacttaaagaactgtcagatttcttaccctcgtgggtgagccag
gaacagatcacagacctgctgatgagttctgaaggtgatgttgttaaagcagcatcgatt
ttttttgagcgggaaagagatttctttgaagaagcaaatgtttcttgtaatggcacaccc
aagacagagaaaaaccattcttctaatcatgggtcgtctgctgatgtaagtagtcagcaa
gaatcttctttattttcacagaagcctgtggaatactctgcaaaactggtaaatttgtct
cctatgagaatgaaaccaaatactcccaaaaaggtaaataagaggggttccagcaataca
aacaagccaaaaaagaaaggccgattaacttcctcaacagaatctggtgggcggaagcag
tccacaattacaaattatttcattagagctactgaagctgcttttaaaaggtgtagacct
gaaagagtaactgtggaggcacatcaaaataacgtggaaaacagtgatcagttagctgat
actgaaaaaacacaagatcagattgtagaccagcttctccagattgtagatggtagcatg
tctagagaatatgcagtttatttgcttgagaaggcaaacggagatgtggctgtagcagtt
gacatattttacagttcaagtgagggtaataatgtaattgaggttgacaagaatattatg
ctgcagaatgcacaaggtgaaactgcagataattgtagtgaaacagacatggctagtggt
tattctcaggctactccaaaaatgtcaaacttacatgtaggaacttctttagcacatgga
gattctgccaacacatcactgctaattgaaaagtatctacctattgaacatgcttgctgg
atagcaggacagcctgcaccatacttgcatttggctcgcacatttgacttggttgaaaag
gaaaaaggaaagatcaaaactatcgcaatattttgcaacatgttcaggagtttgcttgct
ttatcccctgatgatgttctacctgctgtttatctatgtactaataaaatttctcctgac
catgaaaatatggaactgaacattggtgggagtctagttgtaactactctggaggaatca
ttaggaaccagcagatctaaaatacatgaaatgtacaaaacttacggtgatcttggtact
gttgcccaagaatgtcgtcagaatcaaacactaattgctcctccccgttctctctcgatt
tgtgatgtatattccacgcttcggaaactaagtgcaatatcaggtagtggaagtgctggg
aggagaaaaaatcttgtcttgcatctgattcggtcttgtagagaaacagaaatgaaattt
cttgtcagaacactggttcgtaacttgcgtattggggctatgatgaagacgattttacct
gcgcttgcacatgctgttgtttttgatagaaactgtgcagcagatcctgcggtgtcattg
gaaggcataaaatcacaactacagagtctttcaactgaagttgccgaggcatacaatgtc
actcctaatctagatttgctcattccttctcttctgagagaaggcactgcattttcagct
tcatccttggcaatggtgcctggcacacctattccacctatgcttgcaagaattactaac
gggttgactcagtcgttgaaagctttccatggcagatcatttacttgtgagtacaagtat
gatggtcagcgtgcccagattcacaaagcacttgatggatccgtgcgaatattttcaagg
caaatgaaagaatcaacttccagatttcctgatcttgtgaatatgattaaggagttgtgc
aagcccgaagtgtcaagctttatactggatgccgaggtggtaggaattaacaggaagaaa
ggaaatgagttgatgtcgttccaagagctatcttcaagagaaagagggaataagcattcc
tcaatttcaatagagaacataaaggttgacatttgtgtgtttgtttttgacatcatgttc
catgatggagagagactactggattgccctcttcggcaaagaagaaagtacattcatgac
ttgttccatgagaagccaggatattttgagttagctcagcagctaaatatagaagcctgc
gaagcttcaccagacaattctagcactttggctaggatggacacgtttttcagaaatgca
tgccagtcttcttgtgagggtataatgttaaagactttggatgtcgatgctggatactct
gcttccaaacgctgtgattcatggttaaaggtcaagcgtgactatgtgcaaggcttaggt
gatagccttgacttggttccgattggtgcatggtatggaaacggacgtaaagctgggtgg
tacagcccttttctcatggcatgctacaaccctgaaactgaagagttccaaagtgtatgt
cgtgttatgtctggtttctcggatgagttctataaagagatgaaggagttctattcgggg
gaaaggatactgcccaagaagcctgtttactacaaaacagacgagcaaccagagctgtgg
ttcaccgcagaacaaatctgggagatccgaggtgcagacctgacgttgtcccctgtccac
catgcggccattgggcttgtccatccatcgcgcggcatctcggtgaggatgccccggtac
atccgttcagttccagaccggagcccagaggactgcggcacggccgccgatattgctagc
atgttcaaagcccagacccggaagatggatgtcagcagcgagggccaggagtag

DBGET integrated database retrieval system