KEGG   Zea mays (maize): 541954Help
Entry
541954            CDS       T01088                                 

Gene name
mez1
Definition
(RefSeq) histone-lysine N-methyltransferase EZ1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
zma  Zea mays (maize)
Pathway
zma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    541954 (mez1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zma03036]
    541954 (mez1)
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     541954 (mez1)
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     541954 (mez1)
   Polycomb group proteins
    PRC2-EZH2 complex
     541954 (mez1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 541954
NCBI-ProteinID: NP_001105078
UniProt: Q8S4P6 A0A1Q1AV08
LinkDB All DBs
Position
6
AA seq 931 aa AA seqDB search
MEAEAAAAVVASSASASASAGRSRPSSSAAQVTSNSAVRAGEENAASLYVLSVIDSLKKR
ITADRLTYIKNRIGENKTNISSYTQRTYNLSKNRQISTSKGTDSASNLLTKRQDDALCTL
HSLDIIPVDKDGGTFQDESPFSSSNVMFGGNLGPKNAIIRPIKLPEVPKLPPYTTWIFLD
RNQRMTEDQSVLGRRRIYYDTSCGEALICSDSEDEAIEDEEEKKEFKHSEDHIIRMTVQE
CGMSDAVLQTLARHMERAADDIKARYEILHGEKTKDSCKKGTEHNVKVEDLYCDKDLDAA
LDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQPAWSGVDDSVPCGIHCHKLASEPDAAA
GADHMLFDVEEPTHSSDNVMNQPGSNRKKNGSSGRKTKSQQSESSSTARVISESSDSEVH
PISNKSPQHSPSPSKVKIGPKGGIRKITNRRIAERILMSVKKGQREMASSDSNFVSGYLL
ARDMKLRSDTRNGNKELIVSSQQSSPSTRSSKKKSTPQIGNSSAFAEAHNDSTEEANNRH
SATDGYDSSRKEEFVNENLCKQEVYLRSWKAIEQGLLVKGLEIFGRNSCLIARNLLGGMK
TCKDVFQYMNYIENNSASGALSGVDSLVKGYIKGTELRTRSRYFRRRGKVRRLKYTWKSA
GYNFKRITERKDQPCRQYNPCGCQSTCGKQCPCLSNGTCCEKYCGCPKICKNRFRGCHCA
KSQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRV
LLGRSDVSGWGAFLKNSVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNEYV
LDAYRMGDKLKFANHAPDPNCYAKVIMVTGDHRVGIFAKERILAGEELFYDYRYEPDRAP
AWARKPEASGAKDDGQPFNGRAKKLAQNNRG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagaggctgccgcggcggtagtggcgtcgtccgcatctgcctcggcttccgcg
ggccggtctcgcccatctagcagcgccgcccaggtcaccagtaattcggctgtgcgagct
ggagaagaaaatgctgcctccctctatgttttatctgttattgactcgttaaaaaagagg
attaccgcagatcgtttgacttacattaagaataggataggggagaacaagactaatatc
agcagctatacacagaggacttacaatttatcaaaaaataggcaaattagtacatcaaag
ggtactgattcagcatcaaatttgctcacaaaaaggcaagatgatgcgctatgcaccctg
catagtcttgatattattccggttgacaaagatggtggtacttttcaagacgaaagtcct
ttctcttcatctaatgttatgtttggtggaaatcttggtcccaagaatgctattattaga
ccaattaaactaccagaagtgccaaagcttccaccttatacaacatggatatttttggac
aggaaccaaaggatgacagaagaccaatctgtacttggtcgacggaggatttactatgat
accagttgtggtgaagctctaatttgcagtgatagtgaagatgaagccattgaagatgag
gaggaaaaaaaggaatttaaacattctgaagatcacattattcggatgacagttcaagaa
tgtggcatgtctgatgctgtactgcaaacgctagctcgacacatggagcgggctgctgat
gacataaaggccaggtatgaaattctgcatggtgagaaaactaaggattcttgcaagaaa
gggactgagcataatgtcaaagtggaagatttgtactgtgacaaagatttggatgcagca
ttggattcttttgacaatctcttctgtcgacgatgtctagtgtttgattgcaagctacat
gggtgttctcaagatttagtatttcctacagaaaaacaaccagcttggagtggcgttgat
gacagtgtaccctgtggtattcattgccataaactggcatctgaaccagatgctgctgct
ggtgctgatcacatgctttttgatgttgaggagccaactcactcatcagacaatgtgatg
aaccagccaggttcaaataggaaaaagaacggctccagtggaaggaagactaaatctcaa
caaagtgaaagctcttcaactgcaagagttatctcagaaagcagtgattcggaagtacat
ccaataagcaataaatctccacaacactcccctagtccctcaaaagttaaaattgggccg
aaaggtggaatcagaaagattaccaatagacgaatcgctgagagaattcttatgagtgtg
aagaaaggacaaagggaaatggcatcatctgattctaattttgttagtggatatcttttg
gcaagggacatgaagcttaggtctgatacacgaaatggaaataaggaattaattgtatcc
tcacaacagagttctccaagcacaagaagttccaaaaagaagagtacacctcaaattggg
aacagctcagcttttgctgaggctcataatgattcaacagaggaagcaaataaccgtcat
tcagcaacagatggttacgatagttcaaggaaagaagaattcgtcaatgagaatttatgc
aagcaggaggtgtacttgagatcatggaaggcaattgagcagggacttcttgtgaaagga
ttagagatttttggaaggaacagttgtttaattgctcggaaccttcttggtggaatgaag
acgtgcaaagatgtttttcaatatatgaattatattgaaaacaacagtgcctctggagct
cttagtggtgttgattctcttgttaaaggatatattaagggtactgagttgcgcacaaga
tcaagatattttagaaggcgaggtaaagtccgtcgtttgaagtacacctggaaatctgca
ggttacaatttcaaaaggattaccgaaaggaaggatcagccttgtcgacaatataatcct
tgtggttgtcaatctacatgcggaaagcagtgtccatgtctttcaaatgggacatgttgt
gagaaatactgtgggtgtccaaaaatttgcaagaatcgttttcgaggatgtcactgtgca
aagagccagtgtcgcagccgccaatgtccatgttttgcagctgacagggaatgcgatccg
gatgtttgcagaaactgttgggttgggtgtggtgatggtacattgggagttccaaaccag
agaggagataattatgaatgccggaacatgaaactgcttcttaaacaacaacaaagggtc
ttacttggaagatcagatgtctctggctggggagcattcctcaagaatagtgttagcaaa
catgaataccttggtgagtacactggggaactaatctcacacaaagaagcagataagcgt
ggaaagatatatgatcgtgagaactcatcgttccttttcaacctgaacaatgagtatgtt
cttgacgcatacagaatgggtgacaagctgaaatttgccaaccatgcccctgacccgaat
tgctatgccaaggttatcatggtaactggtgatcatagagtgggcatattcgccaaagaa
agaatcctcgctggtgaagagttattctacgattaccgctatgagcctgacagagctcct
gcttgggcccgtaagcctgaggcgtcgggagcaaaggatgatgggcaaccgttcaatggg
cgtgcaaagaagctcgcccaaaacaaccgaggctga

DBGET integrated database retrieval system