KEGG   Zea mays (maize): 542393Help
Entry
542393            CDS       T01088                                 

Gene name
pep4
Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zma  Zea mays (maize)
Pathway
zma00620  Pyruvate metabolism
zma00710  Carbon fixation in photosynthetic organisms
zma01100  Metabolic pathways
zma01200  Carbon metabolism
Module
zma_M00168  CAM (Crassulacean acid metabolism), dark
zma_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
zma_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
zma_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    542393 (pep4)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    542393 (pep4)
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     542393 (pep4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 542393
NCBI-ProteinID: NP_001105438
UniProt: P51059
LinkDB All DBs
Position
7
AA seq 967 aa AA seqDB search
MAALGPKMERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQ
ECYEVAAEYETKHDLQKLDELGKMITSLDPGDSIVIAKSLSHMLNLANLAEEVQIAYRRR
IKLKKGDFADENSAITESDIEETLKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVR
RSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRA
GMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEV
TRDVCLLARMMASNLYCSQIEDLMFELSMWRCSDELRMRADVLHLSTKKDAKHYIEFWKK
VPPNEPYRVILSDVRDKLYNTRERSRELLSSGHSDIPEEATLTNVEQLLEPLELCYRSLC
ACGDSVIADGTLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTYLGIGSYREWTEE
RRQEWLLSELNGKRPLFGSDLPKTEEISDVLDTFHVIAELPSDNFGAYIISMATAPSDVL
AVELLQRECHVKTPLRVVPLFEKLADLEAAPAALARLFSIDWYRQRINGKQEVMIGYSDS
GKDAGRLSAAWQLYKAQEELIKVAKDFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPNAPKPEWRALLDEMAVVA
TEEYRSIVFKEPRFVEYFRLATPETEYGRMNIGSRPSKRKPSGGIDSLRAIPWIFAWTQT
RFHLPVWLGFGAAFKNVLQKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGNPGIAALY
DKLLVSEELHPLGEKLRANYEETQKLLLQVAGHRDLLEGDLYLKQRLRLRDAYITTLNVC
QAYTLKRIRDPDYHVALRPHLSKEIMDSTKAAADVVKLNPGSEYAPGLEDTLILTMKGIA
AGLQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggctgccttagggccgaagatggagcgtctgtcgtcgatcgacgcgcagctgcggatg
ctggtgccggggaaggtttcggaggacgataagctcatcgagtacgacgctctcctcctc
gatcggttcctcgacatccttcaggacctccatggcgacgacctcaaggaaatggttcaa
gaatgctatgaggtagctgctgagtatgaaacaaaacatgacttgcaaaagcttgatgaa
ctcgggaagatgataacaagcttggatcctggggactctatcgtgattgctaagtctctc
tcgcacatgcttaacttggccaacttggctgaggaagtccagatagcctacaggaggaga
atcaagctcaagaagggagactttgctgatgagaactcggcaatcacagaatctgacatt
gaggaaacacttaagaggcttgttgttgacctgaagaagtcacctgctgaggtatttgat
gccctcaagagccagactgttgatctggttttgactgcacatccaacacagtctgtgagg
aggtcactgctccagaaacactcgaggatacgcaactgtttggttcaactctactcaaaa
gatatcactccggatgataagcaggaacttgatgaggctctgcaaagagagatccaagct
gcctttagaactgatgagatccgaagaacacagcccactccccaagatgaaatgcgtgct
ggtatgagctacttccacgaaacaatttggaagggtgttccaaagttcttgcgccgggtt
gatactgcattgaagaacattgggattaacgagcgtgttccttacaatgcacctcttatt
caattctcttcttggatggggggagatcgtgatggaaatccaagagtgacaccagaggtt
accagggatgtctgcttgcttgccagaatgatggcatcaaacttgtactgctctcagatt
gaggatctcatgtttgagttgtctatgtggcgatgcagtgatgaactgcgcatgcgagct
gatgtgctgcatctctccactaagaaggatgccaaacattacatagagttttggaagaag
gttcctccaaatgagccatatcgggtgatactgagtgatgtcagggataaactgtacaac
actcgtgaacggtcacgagagcttttatccagtgggcattctgatattcctgaggaagct
acattgacaaatgttgagcagctgttggagcccttggaactatgttacagatcactctgt
gcttgtggtgactctgtaattgctgatggaacccttctggatttcttgcgtcaagtgtcc
acctttggactctcccttgtgaggcttgacattaggcaagagtcagataggcatactgat
gtccttgatgccatcactacatacctggggataggatcttaccgtgaatggactgaagaa
cgccgccaagaatggttactgtctgaacttaatggcaagcgccctctgtttggctcagac
cttcccaagactgaggaaatttctgatgttctagacacattccatgttattgctgagctt
ccctctgacaattttggtgcgtatatcatttccatggcgacagctccgtcggacgtcctt
gctgttgaactcctccaacgtgagtgtcatgtgaaaacaccacttagagtagtcccgctg
tttgagaagttggccgatcttgaggctgccccggctgcattggccagactgttctcaata
gattggtacagacagaggatcaatggcaagcaggaggtcatgattgggtattcagactcg
ggcaaagatgctggtcgcctctcagcagcttggcagctatacaaagctcaggaggagctc
atcaaggttgctaaggactttggtgtgaagttaacgatgttccatggacgtggtgggact
gttggaaggggtggtggtcccactcaccttgccatcttgtcccagccaccagacacgatc
cacggatcactcagggtcactgtgcaaggtgaagtcattgaacagtcatttggtgaggag
cacttgtgctttaggacactgcaacgtttcacggctgctaccctggagcatggcatgcac
ccaccaaatgcaccaaagccagaatggcgagcccttcttgatgagatggcagttgtggca
actgaggaatatcggtccattgtcttcaaagagccacgctttgtcgagtatttccgcctt
gcaacccctgaaacagagtatggtaggatgaacataggaagcaggccatccaagagaaag
ccgagcggaggtatcgactcactccgagcaatcccatggatctttgcttggacacaaacg
cggttccacctcccggtctggctaggatttggagccgcattcaagaatgtcctccagaag
gacatcaggaacctccacatgctccaggaaatgtacaatgagtggccatttttcagggtg
actattgatctggtggagatggtgttcgccaagggtaatcctggcattgccgcactgtat
gacaaactcctcgtttcagaggaactgcatccattgggtgagaagctgagggccaactat
gaggaaacccagaagcttctacttcaggttgctgggcacagggatcttctggaaggtgac
ctctacctgaagcagcggctccgcctgcgtgatgcgtacatcaccaccctgaacgtctgc
caggcctacaccctgaagcggatccgtgacccggactaccatgtcgcgctgcgcccccac
ctctccaaggagatcatggactcgaccaaggctgcggcggacgtggtgaagctgaaccct
ggcagcgaatacgcaccggggctggaggacaccctcatcctgaccatgaagggcatagca
gccggcctccagaacaccggttaa

DBGET integrated database retrieval system