KEGG   Zea mays (maize): 542479Help
Entry
542479            CDS       T01088                                 

Gene name
pep7
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zma  Zea mays (maize)
Pathway
zma00620  Pyruvate metabolism
zma00710  Carbon fixation in photosynthetic organisms
zma01100  Metabolic pathways
zma01200  Carbon metabolism
Module
zma_M00168  CAM (Crassulacean acid metabolism), dark
zma_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
zma_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
zma_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    542479 (pep7)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    542479 (pep7)
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     542479 (pep7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 542479
NCBI-ProteinID: NP_001105503
UniProt: Q9SAZ6
LinkDB All DBs
Position
5
AA seq 960 aa AA seqDB search
MPERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYELS
AEYENDRDEARLGELGSKLTSLPPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIKLKRG
DFADEASAPTESDIEETLKRLVSQLGKSREEVFDALKNQTVDLVFTAHPTQSVRRSLLQK
HGRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH
ETIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL
LARMMAANLYFSQIEDLMFELSMWRCSDELRIRADELHRSSRKAAKHYIEFWKQVPPNEP
YRVILGDVRDKLYYTRERSRHLLTSGISEILEEATFTNVEQFLEPLELCYRSLCACGDKP
IADGSLLDFLRQVSTFGLALVKLDIRQESDRHTDVLDSITTHLGIGSYAEWSEEKRQDWL
LSELRGKRPLFGSDLPQTEETADVLGTFHVLAELPADCFGAYIISMATAPSDVLAVELLQ
RECHVKHPLRVVPLFEKLADLEAAPAAVARLFSIDWYMDRINGKQEVMIGYSDSGKDAGR
LSAAWQMYKAQEELIKVAKHYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRV
TVQGEVIEHSFGEELLCFRTLQRYTAATLEHGMHPPISPKPEWRALMDEMAVVATKEYRS
IVFQEPRFVEYFRSATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPV
WLGFGAAIKHIMQKDIRNIHILREMYNEWPFFRVTLDLLEMVFAKGDPGIAAVYDKLLVA
DDLQSFGEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYITTLNVCQAYTLK
RIRDPSFQVSPQPPLSKEFTDESQPAELVQLNQQSEYAPGLEDTLILTMKGIAAGMQNTG
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcggcaccagtccatcgacgcgcagctgcggctgctggcccccgggaaggtc
tccgaggacgacaagctcgtcgagtacgacgccctcctcgtcgaccgcttcctcgacatc
ctccaggacctgcacggcccccacctgcgcgaattcgtgcaggagtgctacgagctctcg
gcggagtacgagaacgaccgggatgaggctcggcttggcgagctcgggagcaagctcacc
agcctgccgccgggggactccattgtcgtcgccagttccttctcgcacatgctcaacctc
gctaacctcgccgaggaagtgcagatcgcgcaccgtcgccggatcaagctaaagcgggga
gacttcgccgacgaggcctccgcgccgacggagtcggacatcgaggagacgctcaagcgc
ctcgtctcgcagctcggcaagtcgcgggaggaggtcttcgacgcgctcaagaaccagacc
gtcgacctcgttttcaccgcccaccctacacagtccgtgaggaggtctcttctccagaag
catggaaggatccgtaactgcctgaggcagctttatgccaaggacatcactgctgacgac
aagcaggagcttgatgaggcacttcagagggagattcaagctgctttcagaactgatgaa
atccgcagaacccctcccactcctcaagatgaaatgcgtgctggaatgagttacttccat
gaaactatatggaagggtgtaccaaaattcttgcgccgtattgacaccgctctgaaaaat
attgggatcaatgaacgtctcccttacaatgctcctctcattcagttctcttcctggatg
ggtggtgatcgtgatggaaatccaagagtaacaccagaggttacacgggatgtatgcttg
ttggcgagaatgatggctgctaacttgtacttctctcagattgaagatttaatgtttgag
ctgtctatgtggcgctgcagtgatgaacttcggatccgtgcagatgaactacatcgctct
tcaagaaaagctgcaaagcactatatagaattctggaagcaagttccgccaaatgaacca
tatcgtgtcatacttggtgatgtcagggataaattgtactacacacgtgaacgttctcgt
cacctattgacatctggaatttctgagattctagaggaggcaacttttactaatgttgaa
cagtttctggaacctcttgagctctgttatagatcattatgtgcttgtggtgacaaacct
atagctgatggaagtcttcttgatttcttgcgtcaagtatcaacttttgggcttgccctt
gtgaagctcgacatcaggcaggaatctgatcgacacactgatgtccttgattcgataacg
acacatcttggaattggctcctatgctgaatggtctgaggagaaacgccaggattggctg
ttgtctgaactgaggggcaaacgtccattgtttggttcagatcttcctcagactgaagag
actgctgatgttttaggcacatttcatgtccttgcagagcttcctgcagattgctttggc
gcgtatatcatctctatggcaactgccccatccgatgtgcttgcggtcgagcttttgcag
cgtgagtgccatgtaaaacatccactgagagttgttccactttttgagaaacttgcagat
cttgaagcagctccagcagctgtagcacggctcttttcaattgactggtacatggatagg
attaatggcaagcaggaggtcatgattggatattcagactctggcaaagatgccgggcgt
ctctctgcagcatggcaaatgtataaagcacaagaagagctcatcaaagtggcaaagcat
tatggagtcaagttgacaatgtttcatgggaggggtggaacagttggcagaggaggtggt
ccaactcatctggccatattatctcagccaccagacacgatacatggatcacttcgtgta
acagttcaaggcgaagttattgagcactcctttggagaggagctcttgtgcttcagaact
ttgcaacgctacactgcagctactcttgagcatggcatgcatcctccgatttcccctaag
ccagaatggcgtgctctgatggatgaaatggctgttgtagcaactaaagaatatcgatca
attgtcttccaagaaccacgcttcgttgaatacttcagatcggctacacctgagactgaa
tatggtaggatgaatattggcagccgtccatcaaagaggaagcctagtgggggaatagaa
tcactccgtgcaattccatggatctttgcttggacacaaacaaggttccatctgcctgtc
tggcttggatttggtgcagcgataaagcacatcatgcagaaggacatcaggaacatccat
atactgagagaaatgtacaatgagtggccattcttcagggtcacccttgatttgcttgag
atggttttcgcgaagggagacccgggaatcgcagctgtgtacgacaaattgctagtggct
gatgatttgcaatccttcggcgagcaactgaggaagaactatgaggagacaaaagagcta
ctccttcaggttgctggtcacaaggacgtccttgaaggtgatccttatctgaagcagcgt
ctgcggctgcgtgagtcctacatcaccactctgaacgtgtgccaggcctacaccctgaag
cggatacgcgacccgagcttccaggtgagcccgcagccgcccctgtccaaggagttcacc
gacgagagtcagccggcggagctggtgcagctgaaccagcagagcgagtacgctccaggc
ctggaggacaccctcatcctgaccatgaagggcatcgccgccggcatgcagaacaccggc
tag

DBGET integrated database retrieval system