KEGG   Zea mays (maize): 542522Help
Entry
542522            CDS       T01088                                 

Definition
(RefSeq) alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
zma  Zea mays (maize)
Pathway
zma00500  Starch and sucrose metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    542522
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     542522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 542522
NCBI-ProteinID: NP_001105539
UniProt: B4G231 Q41770
LinkDB All DBs
Position
2
AA seq 439 aa AA seqDB search
MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKQGGWYNYLLGRVDDIAAT
GATHVWLPPPSHSVAPQGYMPGRLYDLDASKYGTHAELKSLTAAFHAKGVQCVADVVINH
RCADYKDGRGIYCVFEGGTPDSRLDWGPDMICSDDTQYSNGRGHRDTGADFAAAPDIDHL
NPRVQQELSDWLNWLKSDLGFDGWRLDFAKGYSAAVAKVYVDSTAPTFVVAEIWSSLHYD
GNGEPSSNQDADRQELVNWAQAVGGPAAAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMI
GWLPEKAVTFVDNHDTGSTQNSWPFPSDKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEI
SALSAVRSRNGIHPGSELNILAADGDLYVAKIDDKVIVKIGSRYDVGNLIPSDFHAVAHG
NNYCVWEKHGLRVPAGRHH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcacttggctgccatgtgcaggtgcagcctcctagtgcttgtactgctctgc
ttgggctcccagctggcccaatcccaggtcctcttccaggggttcaactgggagtcgtgg
aagaagcaaggtgggtggtacaactacctcctggggcgggtggacgacatcgccgcgacg
ggggccacgcacgtctggctcccgccgccgtcgcactcggtggcgccgcaggggtacatg
cccggccggctctacgacctggacgcgtccaagtacggcacccacgcggagctcaagtcg
ctcaccgcggcgttccacgccaagggcgtccagtgcgtcgccgacgtcgtgatcaaccac
cgctgcgccgactacaaggacggccgcggcatctactgcgtcttcgagggcggcacgccc
gacagccgcctcgactggggccccgacatgatctgcagcgacgacacgcagtactccaac
gggcgcgggcaccgcgacacgggggccgacttcgccgccgcgcccgacatcgaccacctc
aacccgcgcgtgcagcaggagctctcggactggctcaactggctcaagtccgacctcggc
ttcgacggctggcgcctcgacttcgccaagggctactccgccgccgtcgccaaggtgtac
gtcgacagcaccgcccccaccttcgtcgtcgccgagatatggagctccctccactacgac
ggcaacggcgagccgtccagcaaccaggacgccgacaggcaggagctggtcaactgggcg
caggcggtgggcggccccgccgcggcgttcgacttcaccaccaagggcgtgctgcaggcg
gccgtccagggcgagctgtggcgcatgaaggacggcaacggcaaggcgcccgggatgatc
ggctggctgccggagaaggccgtcacgttcgtcgacaaccacgacaccggctccacgcag
aactcgtggccattcccctccgacaaggtcatgcagggctacgcctatatcctcacgcac
ccaggaactccatgcatcttctacgaccacgttttcgactggaacctgaagcaggagatc
agcgcgctgtctgcggtgaggtcaagaaacgggatccacccggggagcgagctgaacatc
ctcgccgccgacggggatctctacgtcgccaagattgacgacaaggtcatcgtgaagatc
gggtcacggtacgacgtcgggaacctgatcccctcagacttccacgccgttgcccatggc
aacaactactgcgtttgggagaagcacggtctgagagttccagcggggcggcaccactag

DBGET integrated database retrieval system