KEGG   Zea mays (maize): 542722Help
Entry
542722            CDS       T01088                                 

Gene name
sod4
Definition
(RefSeq) superoxide dismutase [Cu-Zn] 4AP
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
zma  Zea mays (maize)
Pathway
zma04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:zma00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    542722 (sod4)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     542722 (sod4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 542722
NCBI-ProteinID: NP_001105704
UniProt: P23345 P23346 C4J9A9
LinkDB All DBs
Position
1
AA seq 152 aa AA seqDB search
MVKAVAVLGSSEGVKGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG
PHYNPASKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgctgtgctgggtagcagcgagggtgtcaagggcacaatcttcttc
acccaagaaggggatggccctaccactgtcactggaagtgtctctggcctcaagcctggc
ctccatgggttccatgtgcatgcacttggtgacaccaccaatggctgcatgtcaactgga
ccacactacaatcctgcgagcaaggaacatggagcaccagaagatgagaaccgccatgcc
ggtgatcttggaaatgtgacagctggagcagacggtgttgcaaacattaatgttaccgac
agccagatcccactgactgggccaaactcaatcattggcagagctgttgttgttcacgct
gatcccgatgatcttggaaagggtggacacgagctcagcaagagcaccggaaacgctggc
ggccgtgttgcttgtgggatcatcggactccagggctga

DBGET integrated database retrieval system