KEGG   Zea mays (maize): 732806Help
Entry
732806            CDS       T01088                                 

Gene name
rf2
Definition
(RefSeq) mitochondrial aldehyde dehydrogenase 2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma00053  Ascorbate and aldarate metabolism
zma00071  Fatty acid degradation
zma00280  Valine, leucine and isoleucine degradation
zma00310  Lysine degradation
zma00330  Arginine and proline metabolism
zma00340  Histidine metabolism
zma00380  Tryptophan metabolism
zma00410  beta-Alanine metabolism
zma00561  Glycerolipid metabolism
zma00620  Pyruvate metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    732806 (rf2)
   00053 Ascorbate and aldarate metabolism
    732806 (rf2)
   00620 Pyruvate metabolism
    732806 (rf2)
  Lipid metabolism
   00071 Fatty acid degradation
    732806 (rf2)
   00561 Glycerolipid metabolism
    732806 (rf2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    732806 (rf2)
   00310 Lysine degradation
    732806 (rf2)
   00330 Arginine and proline metabolism
    732806 (rf2)
   00340 Histidine metabolism
    732806 (rf2)
   00380 Tryptophan metabolism
    732806 (rf2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    732806 (rf2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    732806 (rf2)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     732806 (rf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 732806
NCBI-ProteinID: NP_001105891
UniProt: Q43274
LinkDB All DBs
Position
9
AA seq 549 aa AA seqDB search
MARRAASSLVSRCLLARAPAGAPPAAPSAPRRTVPADGMHRLLPGVLQRFSTAAAVEEPI
TPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVAAARKAFD
EGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAAQIEVPMVARLMRYY
AGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMYAWKVGPALACGNTLVLK
TAEQTPLSALYISKLLHEAGLPEGVVNVVSGFGPTAGAALASHMDVDKIAFTGSTDTGKI
ILELAAKSNLKTVTLELGGKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHE
RVYDEFVEKAKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRYGVDGGATLVTGGD
RLGDKGFYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVF
TNSLDTANTLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGVDSLKNYLQVKAVV
TPIKNAAWL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctcggagggccgcgtcctcgctcgtctcccgctgcctcctggcgagggcccctgcc
ggcgcgccgcccgctgccccctctgcgccgcgcaggacagtgcctgcagatgggatgcac
aggctgttgccaggtgtccttcagaggttcagcactgcagcagcagtagaggagcccatc
acgccgtcagtccatgtgaactacacaaagctcctcattaatgggaactttgttgattcc
gcatccggcaagaccttcccaactctggaccctcgtacaggggaggtgattgctcatgtg
gctgagggtgacgcagaggacattaaccgtgcagtagctgcggctcgcaaggcttttgat
gaagggccatggccgaagatgactgcctatgagaggtcccgtatcctactgcggtttgct
gatttgatagagaagcacaatgacgagcttgctgctttggagacatgggacaacgggaag
ccatatgagcaagcagcccagattgaagtacccatggtggcccgtcttatgcgttactat
gctggttgggctgataagatccatgggctcattgtgccggctgatggcccacaccatgta
cagatcttgcatgagccaattggtgttgcaggtcagatcatcccatggaactttcctctt
ctgatgtatgcctggaaagttggccctgctttggcatgtggaaatactctcgtgctcaag
actgctgaacaaacccctctatcggctttgtatatctccaaattgttgcatgaggctgga
ctacctgagggtgttgtgaatgtcgtttctggttttggccctactgctggtgctgctctt
gctagtcacatggatgttgataagatcgcatttactggatctaccgatactggaaaaatt
attctcgagttggctgcaaagagcaaccttaagacagtgacactggagttaggaggcaag
tcccctttcatcataatggacgatgctgatgttgaccatgctgttgagcttgcgcacttt
gccctgttctttaaccagggacaatgctgctgcgctggatctcgcacgtttgtacatgag
cgtgtttatgatgagtttgtggagaaggccaaggctcgtgcattgaagcgcgtcgttggt
gatccgttcaggaaaggtgttgaacagggcccgcagattgacgacgagcaattcaacaag
atcttgcgctacattaggtatggtgttgacggtggagctacccttgtgacgggtggtgat
aggttgggtgacaagggtttctacatccagccaacgattttctcagatgtccaggacggc
atgaagattgctcaggaggagatatttgggcctgtgcagtcgatcctcaagttcaaagac
ctcaatgaggttatcaagagggcaaacgcgagccagtatggattggccgccggcgtgttc
accaacagcctggacacggccaacaccctgacgcgcgcgctcagggccgggaccgtctgg
gtgaactgcttcgacgtcttcgatgctgcgattccgtttggtgggtacaagatgagcggc
atcgggagggagaagggcgttgacagcctgaagaactacctgcaggtgaaggcggtcgtc
accccaatcaagaacgccgcgtggttgtag

DBGET integrated database retrieval system