KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0182Help
Entry
ZZ6_0182          CDS       T02187                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00061  Fatty acid biosynthesis
zmb00780  Biotin metabolism
zmb01100  Metabolic pathways
zmb01212  Fatty acid metabolism
Module
zmb_M00083  Fatty acid biosynthesis, elongation
zmb_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:zmb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ZZ6_0182
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ZZ6_0182
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:zmb01004]
    ZZ6_0182
Enzymes [BR:zmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ZZ6_0182
Lipid biosynthesis proteins [BR:zmb01004]
 Fatty acid synthase
  Component type
   ZZ6_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AFN56086
LinkDB All DBs
Position
203890..204366
Genome map
AA seq 158 aa AA seqDB search
MTETTEKVESIGPLDVKRVMAALPHRFPMLLVDRVETLIPGEKIVAIKAVTINEPFFTGH
FPGNPIMPGVLIVEALAQAAGVLAIESLGLTGTGKLVYFMAINETKFRIPVEPGILLRLE
VEFLQKRAKICKFKARALIEDKVAAETEFTAMIADPAN
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacagagacaacagaaaaggttgaatcgataggcccgcttgacgttaagcgggttatg
gcagctctgcctcaccgttttccgatgctgctggttgatcgggtcgagacactgattccg
ggcgaaaaaattgttgcgatcaaggccgtaacaatcaacgagccgttctttaccggtcat
ttccccggtaatccgattatgccaggtgttttaattgtcgaggccttggcacaagctgcc
ggtgttcttgccattgaaagcttaggactgaccggaaccggtaaactggtttatttcatg
gctattaacgagacaaaattccgcattccggtagaaccgggtattttgttgcggttggaa
gtcgagtttttacaaaaacgggcaaagatttgtaaatttaaagcccgagccttgattgaa
gacaaagtcgcggctgaaacagagttcaccgcaatgatcgctgatccagctaactga

DBGET integrated database retrieval system