KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0458Help
Entry
ZZ6_0458          CDS       T02187                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00473  D-Alanine metabolism
zmb00550  Peptidoglycan biosynthesis
zmb01100  Metabolic pathways
zmb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ZZ6_0458
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZZ6_0458
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ZZ6_0458
Enzymes [BR:zmb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ZZ6_0458
Peptidoglycan biosynthesis and degradation proteins [BR:zmb01011]
 Precursor biosynthesis
  Amino acid ligase
   ZZ6_0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding
Motif
Other DBs
NCBI-ProteinID: AFN56357
LinkDB All DBs
Position
complement(528726..529691)
Genome map
AA seq 321 aa AA seqDB search
MSDKKHVVVLMGGWSSEREISLLSGRHVGKALEEAGYRVTLLDMDRDIAFKLREAKPDVV
FNALHGTPGEDGSIQGLMDLMAIRYTHSGLTASAIAIDKELTKKILTPENIPMPQGCLVE
RESLYKKDPLPRPYVLKPVNEGSSVGVAIIDESFNNGQPIRKDQIDPWKNFKTLLAEPFI
KGRELTVAVMGDKALAVTELCPNNGFYDYKAKYTDGMTTHICPAKIPVEIAEKAMALSLK
AHQLLGCRGPSRSDFRWDDEAGLDGLFLLEVNTQPGMTPLSLVPEQAKQLGIDYVTLCRM
IVEEALAEDTLQETKMAGQGG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaaaaagcatgttgtcgttttaatgggcggatggtcttcggaacgtgaaatt
tcgcttctgtcaggccgtcatgtcggcaaggctttggaagaagctggatatcgcgttacg
ctgctcgatatggatcgggatattgcgttcaagcttcgtgaagctaagccggatgtggtt
tttaacgctttgcatggcacgccgggtgaagatggcagtattcaaggtctgatggattta
atggctatccgttatacccattcgggtttgacggcttcggccattgccattgacaaagaa
ttgaccaaaaagattctgacccctgagaatattccgatgccgcagggctgtttggttgag
cgcgaaagcctttataaaaaagacccgttgccgcgaccttatgtcttgaaaccggtcaat
gaaggctcttctgtcggcgttgcgatcattgatgaatcttttaataacggtcagcccatt
cggaaagaccagattgatccgtggaaaaattttaaaacccttcttgccgaaccttttatt
aaagggcgggaattaaccgtggcagtgatgggtgacaaagccttggctgttaccgaatta
tgcccgaataacggcttttatgattataaagccaaatatactgatggtatgacgacccat
atctgtcctgcaaaaattccggtagagattgccgaaaaggcgatggctctttccttgaaa
gcgcatcaacttttgggatgtcggggcccgtcgcgttccgatttccgttgggatgatgaa
gccggattggatggtttgtttctgttagaggtgaatacccagccgggtatgacaccttta
agcttggttcctgaacaggcaaaacagctgggtatcgactatgttaccttgtgccggatg
attgttgaggaagccttggcagaagacacattacaagaaaccaaaatggcaggacagggt
ggctaa

DBGET integrated database retrieval system