KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0511Help
Entry
ZZ6_0511          CDS       T02187                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00970  Aminoacyl-tRNA biosynthesis
zmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ZZ6_0511
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:zmb03029]
    ZZ6_0511
Enzymes [BR:zmb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ZZ6_0511
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ZZ6_0511
Mitochondrial biogenesis [BR:zmb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ZZ6_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AFN56409
LinkDB All DBs
Position
591868..593340
Genome map
AA seq 490 aa AA seqDB search
MEKYILEGATGSWEIVVGLEVHAQVISKSKLFSGAATAFGAEPNSQVSLIDAAMPGMLPV
VNRECIRQAVRTGLAIGAVINRVSKFDRKNYFYADLPQGYQISQLYHPIVGEGSLLIDVD
GEEREIGIERIHVEQDAGKLMHDQHPDKSYVDLNRAGIALMEIVSKPDIRSPAEAGAYIR
KLRAILRYVGSCDGNMEEGSMRADVNVSVRKAGEPFGTRCEIKNVNSVRFVQAAIEYEAR
RQIEVIEEGGEIIQETRLFDHDKGETRSLRSKEDAHDYRYFPDPDLLPLELPESFIDECR
ESLPELPDAKRQRYITRLNLTPYTASVITADHETAAWFEAMLEYFKAPDAKIATAAANWL
TSDLFGALKKLGRDITDSPVSPKQGAELVGLVADGTLSGSLAKQVFEIMLESGQDPAVIV
EERGLKQTSDTGAIEEVINKILADNQDKVEQYRSGKDKLFGFFVGQTMRAMGGKANPAVV
NEILKKLLSA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatatccttgaaggtgcaaccggcagttgggaaattgtcgtagggctcgaa
gtccacgcacaggttatttcaaaatcaaaacttttttccggtgccgctaccgcgttcggt
gcagaaccgaattcacaggtttctttgattgatgccgctatgccggggatgcttccggtg
gtgaaccgtgaatgtatccgtcaggctgtccgcacgggtctagccattggtgccgttatc
aaccgcgtgtcaaaattcgaccgtaaaaactatttttacgccgatttgccacaaggttac
cagatctcacagctttatcacccgattgtaggcgaaggcagtcttctcatcgatgttgat
ggtgaagaacgcgaaatcggcattgaacgcatccatgttgaacaggatgccggtaaattg
atgcatgaccagcatcccgataaatcctatgtcgatttaaatcgggctggtattgccttg
atggaaatcgtttcaaaaccggatatccgctctccggccgaagccggtgcctatatccgt
aaattgcgggcaatcctgcgttatgtcggttcctgtgatggtaacatggaagaaggctcg
atgcgggctgacgtcaatgtttccgttcggaaagccggtgagccctttggtacgcgctgc
gaaatcaaaaatgtgaactcggttcgctttgtgcaggctgccattgaatatgaagcccgt
cgccagatcgaagtcatcgaagaaggtggcgaaatcatacaggaaacgcgcctgttcgat
catgacaagggcgaaacgcggtcattgcgctcgaaagaagacgcacatgattaccgctat
tttccagatcctgatctgctgcctttggaattgccagaaagcttcatcgacgaatgtcgc
gaaagcctgccggaattaccggatgccaaacgccagcgttacattactcggcttaattta
acgccttatacggcttcggttatcacggccgatcatgaaaccgccgcatggtttgaagcc
atgctggaatatttcaaagcaccagatgccaaaatcgcaacagcagccgccaactggctg
acgtctgatttgttcggtgccttgaaaaaattgggacgtgatatcacggatagtccggtt
tctccgaaacagggggctgaattggtgggtcttgttgctgatggcactttatcaggcagc
ctcgccaaacaggtctttgaaatcatgctggaaagcggacaggatccagcggttattgtc
gaagaacgcgggctgaaacagaccagcgataccggcgctatcgaagaggttatcaacaaa
attcttgctgataatcaggataaagtcgaacaatatcgcagcggtaaagataaacttttt
ggcttcttcgtcggtcagaccatgcgggcaatgggcggtaaagccaatcctgcggtcgtc
aacgaaattctgaaaaagctgttatcagcctaa

DBGET integrated database retrieval system