KEGG   Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023: A265_00420Help
Entry
A265_00420        CDS       T03385                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
zmc  Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023
Pathway
zmc00010  Glycolysis / Gluconeogenesis
zmc00052  Galactose metabolism
zmc01100  Metabolic pathways
zmc01110  Biosynthesis of secondary metabolites
zmc01120  Microbial metabolism in diverse environments
zmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:zmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A265_00420
   00052 Galactose metabolism
    A265_00420
Enzymes [BR:zmc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A265_00420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AHJ71902
LinkDB All DBs
Position
477601..478779
Genome map
AA seq 392 aa AA seqDB search
MRYLSKQIMYLCLGLSVPAAVITPTAAYSAASSVSLSSAPFGTTPEGQPVQIYTLKNANG
VTVRFISYGGIIQSIETPDRDGKAGDIVLGFSDLKGYTVDAAKGGLFFGALIGRYANRIA
NGTYSLGGKTYHVPVTAAPNALHGGTRGFDKYVWTVRPLPATEHEAGAELTLVSPDNDQG
FPGNLTVHVTYTLNDKNELRLRYQAKTDKPTVLNLTNHSYFNLSGEGSGSIENQILKINA
DNYTPTDTTSIPTGEIAPVAGTVLDFRNPMRIGDHLRDNNEQLRYARGYDQNWVINGEYG
KQPRLAAQIFDPKTGRTMDVLTSQPGMQVYTSNSLDGTYYGKSNKQYRQTDAIAFEAEHF
PDSPNHSNFPTTELKPGQVFDYTTIFRFGTRR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctatcaaaacagataatgtatttatgcctcggtttatctgtgccagcagcg
gttatcacaccgacggctgcctatagcgctgcgtcttcggtcagtttaagtagtgcgccc
tttggcaccactcctgaaggccaacctgttcagatttacaccttaaaaaacgctaatggc
gtaaccgttcgttttatttcttatggcggtatcatccaatccatcgaaacgcctgatcgc
gatggtaaagccggtgatattgttctcggattttccgatctcaaaggctacaccgtagat
gcagcgaaaggcggtctcttttttggtgcattgattggtcgatatgccaaccggattgcg
aatggcacttacagcctcggcggcaaaacctatcatgtccccgtaaccgctgcgccgaat
gccttacatggggggacaaggggttttgataaatatgtctggacagtccgtcccctgccc
gccaccgaacatgaagcgggtgcagaattaactttggtcagccccgataatgaccaaggt
ttcccggggaatttaacggttcatgtcacctatacattgaatgacaaaaatgaattgcgg
ctgcgttatcaggctaaaacggacaagccgacggttctcaatctaaccaatcacagctat
tttaacttaagcggcgaaggctccggttcgattgaaaaccagattttaaaaattaacgcc
gataactatacgccgacggatacgacctctattcctactggcgagatagcccctgtagca
ggcactgtccttgatttccgcaatccaatgcgaattggcgatcatttgcgcgataacaat
gaacagctccgctatgcacgcggatatgatcagaattgggttattaacggggaatatgga
aaacaacctcgcctcgcagcccaaattttcgatccgaaaacgggacgaacaatggatgtg
ctgacatctcaaccggggatgcaggtttatacctccaattctttggacggcacttattac
ggcaaaagcaacaaacaatatcgccaaaccgacgctattgcttttgaagctgaacatttt
ccggactcgcccaatcactccaatttcccgacaaccgaactcaaaccgggacaggtattt
gattatacgacgattttccgctttggaacgcgtcgttag

DBGET integrated database retrieval system