KEGG   Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023: A265_00468Help
Entry
A265_00468        CDS       T03385                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
zmc  Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023
Pathway
zmc00473  D-Alanine metabolism
zmc00550  Peptidoglycan biosynthesis
zmc01100  Metabolic pathways
zmc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:zmc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A265_00468 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A265_00468 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A265_00468 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmc01011]
    A265_00468 (ddl)
Enzymes [BR:zmc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A265_00468 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:zmc01011]
 Precursor biosynthesis
  Amino acid ligase
   A265_00468 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding
Motif
Other DBs
NCBI-ProteinID: AHJ71950
LinkDB All DBs
Position
complement(535164..536129)
Genome map
AA seq 321 aa AA seqDB search
MSDKKHVVVLMGGWSSEREISLLSGRHVGKALEEAGYRVTLLDMDRDIAFKLREAKPDVV
FNALHGTPGEDGSIQGLMDLMAIRYTHSGLTASAIAIDKELTKKILTPENIPMPQGCLVE
RESLYKKDPLPRPYVLKPVNEGSSVGVAIIDESFNDGQPIRKDQIDPWKNFKTLLAEPFI
KGRELTVAVMGDKALAVTELCPNNGFYDYKAKYTDGMTTHICPAKIPAEIAEKAMALSLK
AHQLLGCRGPSRSDFRWDDEAGLDGLFLLEVNTQPGMTPLSLVPEQAKQLGIDYVALCRM
IVEEALAEDTLQETKMAGQGG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaaaaagcatgttgtcgttttgatgggcggatggtcttcggaacgtgaaatt
tcgcttctgtcaggccgccatgtcggcaaggctttggaagaggctggatatcgcgtgacg
ctgctcgatatggatcgggatattgcgttcaagcttcgtgaagctaagccggatgtcgtt
tttaatgctttgcatggcacgccgggtgaagatggcagtattcaaggtctgatggattta
atggctatccgttatacccattcgggtttgacggcttcggccattgccattgataaagaa
ttgaccaaaaagattctgacccctgagaatattcctatgccgcagggctgtttggttgag
cgcgaaagtctttataaaaaagacccgttgccgcgaccttatgtcttgaaaccggtcaat
gaaggctcttctgtcggcgttgcgatcattgatgaatcttttaatgacggtcagcctatt
cggaaagaccagattgatccgtggaaaaattttaaaacccttcttgccgaaccttttatt
aaagggcgggaattaaccgtggcggtgatgggtgacaaagccttggctgttaccgaatta
tgcccgaataacggcttttacgattataaagccaaatatactgatggcatgacaacccat
atctgtcctgcaaaaattccggcagagattgccgaaaaggcgatggctctttccttgaaa
gcgcatcaacttttgggatgtcggggcccgtcgcgttccgattttcgttgggatgatgaa
gccggattggatggtttgtttctgttagaggtgaatacccagccgggtatgacacctttg
agtttggttcctgaacaggcaaaacagctgggtatcgactatgtcgccttgtgccggatg
attgttgaggaagccttggcggaagacacattacaagaaaccaaaatggcaggacagggt
ggctaa

DBGET integrated database retrieval system