KEGG   Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023: ZCP4_0773Help
Entry
ZCP4_0773         CDS       T02932                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zmi  Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023
Pathway
zmi00010  Glycolysis / Gluconeogenesis
zmi00020  Citrate cycle (TCA cycle)
zmi00620  Pyruvate metabolism
zmi01100  Metabolic pathways
zmi01110  Biosynthesis of secondary metabolites
zmi01120  Microbial metabolism in diverse environments
zmi01130  Biosynthesis of antibiotics
zmi01200  Carbon metabolism
Module
zmi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZCP4_0773
   00020 Citrate cycle (TCA cycle)
    ZCP4_0773
   00620 Pyruvate metabolism
    ZCP4_0773
Enzymes [BR:zmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ZCP4_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AHB10078
LinkDB All DBs
Position
complement(860055..861377)
Genome map
AA seq 440 aa AA seqDB search
MSIEVKMPALSPTMTEGTLAKWLVKEGDAVKAGDILAEIETDKAIMEFETVDAGIIAKIL
VPEGSENIAVGQVIAVMAEAGEDVSQVAASASSQISEPSEKADVAQKETADSETISIDAS
LDKAISNAGYGNKTENMTASYQEKAGRIKASPLAKRLAKKNHVDLKQVNGSGPHGRIIKA
DIEAFVAEANQASSNPSVSTPEASGKITHDTPHNSIKLSNMRRVIARRLTESKQNIPHIY
LTVDVQMDALLKLRSELNESLAVQNIKISVNDMLIKAQALALKATPNVNVAFDGDQMLQF
SQADISVAVSVEGGLITPILKQADTKSLSALSVEMKELIARAREGRLQPQEYQGGTSSIS
NMGMFGIKQFNAVINPPQASILAIGSGERRPWVIDDAITIATVATITGSFDHRVIDGADA
AAFMSAFKHLVEKPLGILAQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaagtcaaaatgccagcgctttcgcctacaatgacagaaggcacccttgcg
aaatggctggtgaaagaaggggatgccgttaaggcgggcgatattctggccgaaatcgaa
accgataaagcgattatggaatttgaaacggttgatgcagggatcatcgctaaaattcta
gtgccggaaggtagtgaaaatattgctgtaggtcaggtgattgctgtcatggccgaagcg
ggcgaagatgtttctcaagtcgccgcttctgcttcatcacagatatcagaaccttctgaa
aaagcagatgtcgcacagaaagagacggcagatagtgaaacgatatccatcgatgcctct
ctcgataaggcaatcagcaacgcaggttatggcaacaaaacagagaatatgacggcttcc
tatcaagaaaaagcagggcggataaaagccagtcctttggccaagcgcttggctaagaaa
aaccatgttgacctgaaacaggtaaacggtagtggtccccatgggcggattatcaaagct
gatattgaagccttcgttgctgaggctaatcaagcctcttctaatccgtcagtctctacg
ccggaagcctccggtaaaataacgcatgatacgccccataatagcatcaagcttagcaat
atgcggcgcgttattgctcgtcgtctgactgaatccaaacaaaatattcctcacatctac
ttgacggttgatgtccagatggatgctcttttgaagctccgctctgaactcaatgaatcc
ttggctgttcagaatattaaaatctcagtcaatgacatgctgattaaagcacaggcctta
gccttaaaagcaacgcctaacgtcaatgttgcttttgatggcgatcagatgctgcaattc
tcacaggctgatatctctgtcgctgtctctgttgaaggtgggctgattacgcctatcttg
aaacaagctgataccaaaagcttgtctgcgctttctgtcgaaatgaaagagcttattgct
cgcgcaagggaagggcgcttgcaacctcaggaatatcaaggcggaacgtccagtatttct
aatatggggatgtttggtatcaagcagtttaatgctgtcatcaacccgccacaggcttct
atcttggcgattggaagcggtgaaagacggccttgggtgattgatgatgcgatcaccatt
gctaccgttgcaactatcaccggtagttttgatcatcgtgttattgatggtgccgatgcg
gctgcctttatgtcagccttcaagcatttggttgaaaaaccattagggattttagcacaa
tga

DBGET integrated database retrieval system