KEGG   Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023: ZCP4_1477Help
Entry
ZCP4_1477         CDS       T02932                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
zmi  Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023
Pathway
zmi00260  Glycine, serine and threonine metabolism
zmi00270  Cysteine and methionine metabolism
zmi00680  Methane metabolism
zmi01100  Metabolic pathways
zmi01120  Microbial metabolism in diverse environments
zmi01130  Biosynthesis of antibiotics
zmi01200  Carbon metabolism
zmi01230  Biosynthesis of amino acids
Module
zmi_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:zmi00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ZCP4_1477
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZCP4_1477
   00270 Cysteine and methionine metabolism
    ZCP4_1477
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmi04147]
    ZCP4_1477
Enzymes [BR:zmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     ZCP4_1477
    1.1.1.399  2-oxoglutarate reductase
     ZCP4_1477
Exosome [BR:zmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZCP4_1477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 F420_oxidored UPF0020 LXG Hpr_kinase_C IlvN
Motif
Other DBs
NCBI-ProteinID: AHB10758
LinkDB All DBs
Position
complement(1653137..1654720)
Genome map
AA seq 527 aa AA seqDB search
MTRVLISDKMDPRAAEVFRERGVEVDQITGLSPEELKKIINDYDGLAIRSATKVTKDIIA
EAKNLKVIGRAGIGVDNIDIPAASSAGIVVMNTPFGNSITTAEQAIALMFALARQIPEAN
ASTQASKWEKNRFMGVEVSGKTLGLIGAGNIGSIVADRAVGLKMKVIAYDPFLTPERALE
LGIEKADLETLLHKADFITLHVPLTDQTRNILSRENLAKTKKGVRIINCARGGLIDEEAL
KDALESGHVAGAALDVFLKEPAKENPLFGVPNFIATPHLGASTTEAQVNVAIQVAEQMAD
YLLTGGVSNALNMPSLSAEEAPRVRPYMALSEQLGRLLGQLEGDKIKAVSIEVEGAAAHL
DQKPITSAVLSGLMGVYSQSVNMVNAPFLARERGLDVREIRHDREGAYHTLIRVTSRDDK
GQEKSVAGTLFGSEGTRLVEIFGIKVEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNI
GTFHLGRRNTGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHFL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagttttgatttccgataaaatggatcctcgtgccgccgaagtctttcgcgaa
cgcggcgttgaagtcgatcagattaccggcctgtcccctgaagaactgaagaaaatcatc
aatgactatgatggtttggctattcgttcggcaaccaaagttaccaaagacatcattgcc
gaagctaaaaatttaaaagtcatcggccgcgcgggcattggtgttgacaatattgatatt
ccagcagcctcgtcggcgggtattgttgtcatgaataccccttttggtaactcgatcact
accgcggaacaggccattgccttgatgtttgctttggcgcgtcaaattcccgaagccaat
gcctcgacgcaggcaagcaaatgggaaaagaaccgctttatgggggtcgaggtttctgga
aaaactcttggcttgattggtgcgggtaatattggttcaatcgtcgccgatcgggcggtt
ggtctgaaaatgaaggtcattgcctatgacccatttttaacgccggaacgagccttggaa
ttgggcattgaaaaggctgatcttgagacgctgcttcataaagccgacttcattaccctg
catgtgcctttgaccgatcagaccagaaatattctgtctcgcgaaaatctggcgaaaacc
aaaaaaggcgtccgaattatcaactgcgcccgtggcggcctgattgatgaagaagccttg
aaagacgctttggaatccggtcatgttgccggggcagctttggatgtgttcttgaaagaa
ccggccaaggaaaatccgttattcggcgttcctaatttcatcgccacgccacatcttggt
gcatccaccaccgaagcacaggtcaatgttgcgattcaggttgccgaacagatggctgac
tatctgttgacggggggtgtttccaatgccttgaatatgccgtccctttcagccgaagaa
gccccaagggttagaccctatatggctctttccgaacaactgggtcgtctgctcggtcaa
ttggaaggtgataagatcaaagcagtttcgatcgaagtcgaaggcgcagctgcccatctt
gaccaaaaaccaatcaccagtgctgtcctttccggcttgatgggtgtgtattcccagtcg
gtgaatatggttaatgcgcccttccttgcgcgtgagcggggattggatgttcgcgaaatc
cgtcatgatcgcgaaggtgcctatcataccttgatacgggtcacttcgcgcgatgataaa
ggacaggaaaaatcagttgcaggaaccctatttggttccgaaggcacaagactggttgaa
atttttggcatcaaggtcgaagccaatttaagcggcgatatgctgtatatcgtcaatgat
gatgcccccggatttatcggtcggcttggcacccttttaggtaaagccggtgttaatatc
ggcactttccatctgggtcgccgaaatacgggcggtgaagccgtgctgttattatcggtc
gattcgcctgttacggctgggaaaatggcgaaagtcgccgaattatccggcgtgcgtgaa
gtgaaatcgctccacttcctataa

DBGET integrated database retrieval system