KEGG   Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023: ZCP4_1512Help
Entry
ZCP4_1512         CDS       T02932                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
zmi  Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023
Pathway
zmi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:zmi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    ZCP4_1512
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zmi03400]
    ZCP4_1512
Enzymes [BR:zmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     ZCP4_1512
DNA repair and recombination proteins [BR:zmi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     ZCP4_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AHB10793
LinkDB All DBs
Position
complement(1691310..1692047)
Genome map
AA seq 245 aa AA seqDB search
MTKQRQSADFQKKYPNSKKDNKENSLSIAPQESMPERDCPLCPRLASLRHDLQKEHPDWF
NAPVPPFGDDDPWLAIVGLAPGMKGANRTGRPFTGDFAGILLYETLLKYGLATGHYQADI
NDGLKLKGTVVLNSVRCLPPQNKPTTQEMVTCRPFFLGAMAHYPHLKVILALGHIAHQTI
LRAFGITLSSMPFKHGAAYQLSPEIQLVDSYHCSRYNQNTRRLTEDMFEDVFAKIIECRG
NDDQK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcaaagacaaagcgccgattttcagaagaaatacccaaattcaaaaaaggac
aacaaagagaatagcctttccatagcccctcaagaatctatgccggagagggattgcccc
ctttgcccccgattggcaagcctccgccatgatttacaaaaagagcatcctgattggttt
aatgcccctgtgccaccttttggagatgatgatccttggctggctatcgttggccttgcc
cccggtatgaagggtgccaatcgcacggggcgacctttcaccggcgattttgcaggtatt
cttctttatgaaacactgctgaaatatggattggcgaccggtcattatcaggcggatatc
aatgatggtctaaaattaaaggggactgtggttttaaattcagtgcgctgccttccgccg
caaaataaaccgacaacgcaagagatggtgacttgccgcccgttctttctgggagcaatg
gcgcattatccccatctgaaagttattctagccttgggacatattgcacatcagactatt
ttgcgggcttttggcatcactttatcctctatgccttttaagcatggggcagcctatcag
ctttcgccagaaatccagttagtcgatagttatcactgttcgcgctataatcagaacact
cgtcgcctgaccgaagatatgtttgaggatgtttttgcgaaaataatagaatgtcgcggc
aatgacgatcaaaaataa

DBGET integrated database retrieval system