KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0411Help
Entry
Zmob_0411         CDS       T01875                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00010  Glycolysis / Gluconeogenesis
zmm00052  Galactose metabolism
zmm01100  Metabolic pathways
zmm01110  Biosynthesis of secondary metabolites
zmm01120  Microbial metabolism in diverse environments
zmm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:zmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Zmob_0411
   00052 Galactose metabolism
    Zmob_0411
Enzymes [BR:zmm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Zmob_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEH62258
UniProt: A0A0H3G0Q7
LinkDB All DBs
Position
474363..475541
Genome map
AA seq 392 aa AA seqDB search
MRYLSKQIMYLCLGLSVPAAVITPTAAYSAASSVSLSSAPFGTTPEGQPVQIYTLKNANG
VTVRFISYGGIIQSIETPDRDGKAGDIVLGFSDLKGYTVDAAKGGLFFGALIGRYANRIA
NGTYSLGGKTYHVPVTAAPNALHGGTRGFDKYVWTVRPLPATEHEAGAELTLVSPDNDQG
FPGNLTVHVTYTLNDKNELRLRYQAKTDKPTVLNLTNHSYFNLSGEGSGSIENQILKINA
DNYTPTDTTSIPTGEIAPVAGTVLDFRNPMRIGDHLRDNNEQLRYARGYDQNWVINGEYG
KQPRLAAQIFDPKTGRTMDVLTSQPGMQVYTSNSLDGTYYGKSNKQYRQTDAIAFEAEHF
PDSPNHSNFPTTELKPGQVFDYTTIFRFGTRR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctatcaaaacaaataatgtatttatgcctcggtttatctgtgccagcggcg
gttatcacaccgacggctgcctatagcgctgcgtcttcggtcagtttaagtagtgcgccc
tttggcaccactcctgaaggccaacctgttcagatttacaccttaaaaaacgctaatggc
gtaaccgttcgttttatttcttatggcggtatcatccaatccatcgaaacgcctgatcgc
gatggtaaagccggtgatattgttctcggattttccgatctcaaaggctataccgtagat
gcagcgaaaggcggcctcttttttggtgcattgattggtcgatatgccaaccggattgcg
aatggtacttacagcctcggcggcaaaacctatcatgtccccgtaaccgctgcgccgaat
gccttacatggggggacaaggggttttgataaatatgtttggacagtccgtcccctgccc
gccaccgaacatgaggcgggtgcagaattaactttggtcagccccgataatgaccaaggt
ttcccggggaatttaacggttcatgtcacctatacattgaatgacaaaaatgaattgcgg
ctgcgttatcaggctaaaacggacaagccgacggttctcaatctaaccaatcacagctat
tttaacttaagcggcgaaggctccggttcgattgaaaaccagattttaaaaattaacgcc
gataactatacgccgacggatacgacctctattcctactggcgagatagcccctgtagca
ggcactgtccttgatttccgtaatccaatgcgaattggcgatcatttgcgcgacaacaat
gaacagctccgctatgcacggggatatgatcagaattgggttattaacggagaatatggg
aaacaacctcgcctcgcagcccaaattttcgatcctaaaacgggacgaacaatggatgtg
ctgacatctcaaccggggatgcaggtttatacctccaattctttggacggtacttattac
ggcaaaagcaacaaacaatatcgccaaaccgacgctattgcttttgaagctgaacatttt
ccggactcgcccaatcactccaatttcccgacaaccgaactcaaaccgggacaggtattt
gattatacgacgattttccgctttggaacgcgtcgttag

DBGET integrated database retrieval system