KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0509Help
Entry
Zmob_0509         CDS       T01875                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00970  Aminoacyl-tRNA biosynthesis
zmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Zmob_0509
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:zmm03029]
    Zmob_0509
Enzymes [BR:zmm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Zmob_0509
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Zmob_0509
Mitochondrial biogenesis [BR:zmm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Zmob_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AEH62355
UniProt: A0A0H3G5F3
LinkDB All DBs
Position
593136..594608
Genome map
AA seq 490 aa AA seqDB search
MEKYILEGATGSWEIVVGLEVHAQVISKSKLFSGAATAFGAEPNSQVSLIDAAMPGMLPV
VNRECIRQAVRTGLAIGAVINRVSKFDRKNYFYADLPQGYQISQLYHPIVGEGSLLIDVD
GEEREIGIERIHVEQDAGKLMHDQHPDKSYVDLNRAGIALMEIVSKPDIRSPAEAGAYIR
KLRAILRYVGSCDGNMEEGSMRADVNVSVRKAGEPFGTRCEIKNVNSVRFVQAAIEYEAR
RQIEVIEDGGEIIQETRLFDHDKGETRSLRSKEDAHDYRYFPDPDLLPLELPESFIDECR
ESLPELPDTKRQRYITQLNLTPYTASVITADHETAAWFEAMLEYFKAPDAKIATAAANWL
TSDLFGALKKLGRDITDSPVSPKQGAELVGLVADGTLSGSLAKQVFEIMLESGQDPAVIV
EERGLKQTSDTGAIEEVINKILADNQDKVEQYRSGKDKLFGFFVGQTMRAMGGKANPAVV
NEILKKLLSA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatatccttgaaggtgcaaccggcagttgggaaattgtcgtagggctcgaa
gtccacgcacaggttatttcaaaatccaaacttttttccggtgccgctaccgcgttcggt
gcagaaccgaattcacaggtttctttgattgatgccgctatgccggggatgcttccggtg
gtaaaccgtgaatgtatccgtcaggctgtccgcacgggtctagccattggtgccgttatc
aaccgcgtgtcaaaattcgaccgtaaaaactatttttacgccgatttgccacaaggttac
cagatttcacagctttatcacccgattgtgggcgaaggcagccttctcatcgatgtcgat
ggtgaagaacgcgaaatcggcattgaacgcatccatgttgaacaggatgccggtaaattg
atgcatgaccagcatcccgataaatcctatgtcgatttaaatcgggctggtattgccttg
atggaaatcgtttcaaaaccggatatccgctctccggccgaagccggtgcctatatccgt
aaattgcgggcaatcctgcgttatgtcggttcctgtgatggtaacatggaagaaggctcg
atgcgggctgatgtcaatgtttccgttcggaaagccggtgagccctttggcacgcgctgc
gaaatcaaaaatgtgaactcggttcgctttgtgcaggctgctattgaatatgaagcccgc
cgccagattgaagtcatcgaagacggtggcgaaatcatacaggaaacccgcctgttcgat
catgacaagggcgaaacgcggtcattgcgctcaaaagaagacgcacatgattatcgttat
tttccagatcctgatcttctgcctttggaattgccggaaagctttattgacgaatgtcgc
gaaagcctgccagaattaccggataccaaacgccagcgttatattactcagcttaattta
acgccttatacggcttcggttatcacggccgatcatgaaaccgccgcatggtttgaagcc
atgctggaatatttcaaagcacccgatgccaaaatcgccacggctgccgctaactggctg
acgtctgatttgttcggtgccttgaaaaaattgggacgtgatatcacggatagtccggtt
tctccgaaacagggggctgaattggtgggtcttgttgctgatggcactttgtcaggcagc
ctcgccaaacaggtctttgaaatcatgctggaaagcggacaggatccagcggttattgtc
gaagaacgcgggctgaaacaaaccagcgataccggcgctatcgaagaggttatcaacaaa
attcttgctgataatcaggataaggtcgaacaatatcgcagcggtaaagataaacttttc
ggcttcttcgtcggtcagaccatgcgggcaatgggcggtaaagccaatcctgcggtcgtc
aacgaaatcctgaaaaagctgttatcagcctaa

DBGET integrated database retrieval system