KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1492Help
Entry
Zmob_1492         CDS       T01875                                 

Definition
(GenBank) Uracil-DNA glycosylase superfamily
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:zmm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Zmob_1492
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zmm03400]
    Zmob_1492
Enzymes [BR:zmm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Zmob_1492
DNA repair and recombination proteins [BR:zmm03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Zmob_1492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AEH63310
UniProt: A0A0H3FZS3
LinkDB All DBs
Position
complement(1708619..1709356)
Genome map
AA seq 245 aa AA seqDB search
MTKQRQSADFQKKYPNSKKDNKENSLSIAPQESMPERDCPLCPRLASLRHDLQKEHPDWF
NAPVPPFGDDDPWLAIVGLAPGMKGANRTGRPFTGDFAGILLYETLLKYGLATGHYQADI
NDGLKLKGTVVLNSVRCLPPQNKPTTQEMVTCRPFFLGAMAHYPHLKVILALGHIAHQTI
LRAFGITLSSMPFKHGAAYQLSPEIQLVDSYHCSRYNQNTRRLTEDMFQDVFAKIIECRG
NDDQK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcaaagacaaagcgccgattttcagaagaaatacccaaattcaaaaaaggac
aacaaagagaatagcctttccatagcccctcaagaatctatgccggagagggattgcccc
ctttgcccccgattggcaagcctccgccatgatttacaaaaagagcatcctgattggttt
aatgcccctgtgccgccttttggagatgacgatccttggctggctatcgttggccttgcc
cccggtatgaagggtgccaatcgcacggggcgacctttcaccggcgattttgcaggtatt
cttctttatgaaacactgctgaaatatggattggcgactggtcattatcaggcggatatc
aatgatggtctaaaattaaaggggactgtggttttaaattcagtgcgctgccttccgccg
caaaacaaaccgacaacgcaagagatggtaacttgccgcccgttctttctgggagcaatg
gcgcattatccccatctgaaagttattctggccttgggacatattgcacatcagactatt
ttgcgggcttttggcatcactttatcctctatgccttttaagcatggggcagcctatcag
ctttcgccagaaatccagttagtcgatagttatcactgttcgcgctataatcagaacact
cgtcgcctgaccgaagatatgtttcaggatgtttttgcgaaaataatagaatgtcgcggc
aatgacgatcaaaaataa

DBGET integrated database retrieval system