KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1625Help
Entry
Zmob_1625         CDS       T01875                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00620  Pyruvate metabolism
zmm00680  Methane metabolism
zmm01100  Metabolic pathways
zmm01120  Microbial metabolism in diverse environments
zmm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Zmob_1625
  09102 Energy metabolism
   00680 Methane metabolism
    Zmob_1625
Enzymes [BR:zmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Zmob_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEH63439
UniProt: A0A0H3G3P1
LinkDB All DBs
Position
complement(1878383..1881040)
Genome map
AA seq 885 aa AA seqDB search
MTKPRTINQNPDLRYFGNLLGQVIKEQGGESLFNQIEQIRSAAIRRHRGIVDSTELSSRL
ADLDLNDMFSFAHAFLLFSMLANLADDRQGDALDPDANMASALKDIKAKGVSQQAIIDMI
DKACIVPVLTAHPTEVRRKSMLDHYNRIAGLMRLKDAGQTVTEDGLPIEDALIQQITILW
QTRPLMLQKLTVADEIETALSFLRETFLPVLPQLYAEWEKLLGSSIPSFIRPGNWIGGDR
DGNPNVNADTIMLSLKRSSETVLTDYLNRLDKLLSNLSVSTDMVSVSDDILRLADKSGDD
AAIRADEPYRRALNGIYDRLAATYRQIAGRNPSRPALRSAEAYKRPQELLADLKTLAEGL
GKLAEGSFKALIRSVETFGFHLATLDLRQNSQVHERVVNELLRTAVVEADYLSLSEEDRV
KLLRRELSQPRTLFVPRADYSEETRSELDIIQAAARAHEIFGPESITTYLISNGESISDI
LEVYLLLKEAGLYQGGAKPKAAIEAAPLFETVADLENAPKVMEEWFKLPEAQAIAKAHGV
QEVMVGYSDSNKDGGYLTSVWGLYKACLALVPIFEKAGVQIQFFHGRGGSVGRGGGSNFN
AILSQPAGAVKGRIRYTEQGEVVAAKYGTHESAIAHLDEAVAATLITSLEAPTIVEPEFS
RYRKALDQISDSAFQTYRQLVYGTKGFRKFFSEFTPLPEIALLKIGSRPPSRKKSDRIED
LRAIPWVFSWSQVRVMLPGWFGFGQALYDFEDTELLQEMASRWPFFRTTIRNMEQVMARS
DMTIAKHYLALVEDQTNGEAIYDSIADGWNKGCEGLLKATQQNWLLERFPAVDNSVQMRR
PYLEPLNYLQVELLKKWRGGDTNPHILESIQLTINAIATALRNSG
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagccgcgcacaattaatcagaacccagaccttcgctattttggtaacctgctc
ggtcaggttattaaggaacaaggcggagagtctttattcaaccagatcgagcaaattcgc
tctgccgcgattagacgccatcggggtattgttgacagcaccgagctaagttctcgctta
gccgatcttgaccttaatgacatgttctcttttgcacatgcctttttgctgttttcaatg
ctggccaatttggctgatgatcgtcagggagatgcccttgatcctgatgccaatatggca
agtgcccttaaggacataaaagccaaaggcgtcagtcagcaggcgatcattgatatgatc
gataaagcctgcattgtgcctgttctgacagcacatccgaccgaagtgcgtcggaaaagt
atgcttgaccattataatcgcattgcaggtttaatgcggttaaaagatgctggacaaacg
gtgaccgaagatggtcttccgatcgaagatgcgttaatccagcaaatcacgatattatgg
cagactcgtccgctcatgctgcaaaagctgaccgtagccgatgaaatcgaaactgccctg
tctttcttaagagaaacttttctgcctgttctgccccagctttatgcagaatgggaaaaa
ttgcttggtagttctattccaagctttatcagacctggtaattggattggtggtgaccgt
gacggtaaccccaatgtcaatgccgatacgatcatgctgtctttgaagcgcagctcggaa
acggtattgacggattatctcaaccgtcttgataaactgctttccaatctttcggtctca
accgatatggtttcggtatccgatgatattctacgtctagccgataaaagtggtgacgat
gctgcgatccgtgcggatgaaccttatcgtcgtgccttaaatggtatttatgaccgttta
gccgctacctatcgtcagatcgccggtcgcaacccttcgcgcccagccttgcgttctgca
gaagcctataaacggcctcaagaattgctggctgatttgaagaccttggccgaaggcttg
ggtaaattggcagaaggtagttttaaggcattgatccgttcggttgaaacctttggtttc
catttggctaccctcgatctgcgtcagaattcgcaggttcatgaaagagttgtcaatgaa
ctgctacggacagccgtcgttgaagccgattatttatctctatcggaagaagatcgcgtt
aagctgttaagaagggaattgtcgcagccgcgcactctattcgttccgcgcgccgattat
tccgaagagacgcgttctgaacttgatattattcaggcggcggcacgcgcccatgaaatt
tttggccctgaatccattacgacttatttgatttcgaatggcgaaagcatttccgatatt
cttgaagtctatttacttttgaaagaagcagggctgtatcaagggggtgccaagccaaaa
gcggcgattgaagctgcgcctttattcgagacggtggccgatcttgaaaatgcgccaaag
gtcatggaggaatggttcaagctgcctgaagcgcaagccattgcaaaggcacatggcgtt
caggaagtgatggttggctattctgactccaataaggacggcggatatctgacctcggtt
tggggtctttataaggcttgcctcgctttggtgccgatttttgaaaaagccggtgtgcag
atccagtttttccatggacggggtggttccgttggtcgcggtggtggttccaactttaat
gccattctgtcgcagccagccggagccgtcaaagggcgtatccgttatacagaacagggt
gaagtcgtggcggccaaatatggcacccatgaaagcgctattgcccatctggatgaggcc
gtagcggcgactttgattacgtctttggaagcaccgaccattgtcgagccagagtttagt
cgttaccgtaaggccttggatcagatctcagattcagctttccagacctatcgccaattg
gtctatggaacgaagggcttccgcaaattctttagtgaatttacgcctttgccagaaatt
gctcttttaaagatcgggtcacgcccacctagccgcaaaaaatccgaccggattgaagat
ctacgcgctattccttgggtgtttagctggtctcaagttcgggtcatgttacccggttgg
ttcggtttcggtcaggctttatatgactttgaagataccgagctgttacaggaaatggca
agccgttggccgtttttccgcacgactattcgtaatatggaacaggtgatggcacgttcc
gatatgacgatcgccaagcattatctggccttggttgaggatcagacaaatggtgaggct
atctatgattctatcgcggatggctggaataaaggttgtgaaggtctgttaaaggcaacc
cagcagaattggctgttggaacgctttccggcggttgataactcggtgcagatgcgtcgg
ccttatctggaaccgcttaattacttacaggtcgaattgctgaagaaatggcgtggaggt
gataccaacccgcatatcctcgaatctattcagctgacaatcaatgccattgcgacggca
cttcgcaacagcggttga

DBGET integrated database retrieval system