KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0205Help
Entry
Za10_0205         CDS       T01110                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
zmn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Za10_0205
Enzymes [BR:zmn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Za10_0205
Transporters [BR:zmn02000]
 Other Transporters
  Pores ion channels [TC:1]
   Za10_0205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4 DUF5118
Motif
Other DBs
NCBI-ProteinID: ACV74757
LinkDB All DBs
Position
complement(233282..233953)
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKVRFLLGEKGIGYELIRESPWLKRDEFVDMNPAGQTPVMVDSSAPV
ILVDSQVICEFLEETVDRMPLISGTAVHRAEIRRLVSLFDNKLYFEVTAPLMNERMLKRL
VHRQAPDAAILRGAMKNANSHLDYIDWLLDHRRWLAGPVLSLADFAAAAQISVSDYLGGV
DWRGHENSREWYAAMKSRPSFQPILAERMEVILPPDHYDQPDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctttatcagtttcctctttgccctttttcccgaaaggtgcgttttctcctt
ggtgaaaaagggatcggctatgagttgatccgtgaatccccatggctaaaaagagatgaa
ttcgtcgatatgaatccagccggtcaaacgccggttatggtagatagttctgcgcctgtt
attctggtggattcacaggttatctgtgaatttctggaagaaacagtcgatcggatgccg
cttatcagcggaacagccgtgcatagggctgaaataaggcgtttggtttctctctttgat
aacaaactttattttgaagtcaccgcgcctttaatgaatgagcggatgctgaaaaggttg
gttcatcgtcaggcaccggatgccgcaattttgcggggtgccatgaaaaacgccaatagc
catctcgattatattgattggttattggatcatcgtcgttggttggcggggcctgtttta
agtttggcggattttgcggcagcggcacaaatttcggtttccgattatcttggtggcgtt
gattggcgcggtcacgaaaatagtcgcgaatggtatgcggcaatgaagtcccgcccctct
ttccaacctattttagcagagagaatggaggttattttgcctccagatcattacgaccag
ccagatttctaa

DBGET integrated database retrieval system