KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0499Help
Entry
Za10_0499         CDS       T01110                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
zmn00970  Aminoacyl-tRNA biosynthesis
zmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Za10_0499
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:zmn03029]
    Za10_0499
Enzymes [BR:zmn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Za10_0499
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Za10_0499
Mitochondrial biogenesis [BR:zmn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Za10_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACV75048
LinkDB All DBs
Position
590858..592336
Genome map
AA seq 492 aa AA seqDB search
MTRLTDLGVTDLRDGIAKGDFSAKEVAESFLTATNEAEKLNAFITLTPDHALKQAEKADK
DRASGQLKPLSGVPLGIKDLFCTNGYRTTAASKIIDNFVPPYESTITEKLFSAGAGMVGK
LNLDQFAMGSSNETSAFGNVISPWRQKGDDTALTPGGSSGGSAAAVAAKLVPAATGTDTG
GSIRQPASFTGITGLKPTYGRCSRYGVIAFASSLDQAGPMAHSVKDCAALLEVMAGFDPK
DSTSVDVMVPNWEKLLSSDIRGKKIGIPKEYRVDGMAPEIESLWQRGIDMMKDAGAEIID
VSLPHTQHALAAYYIIAPAEASSNLARYDGVRYGERKTPEGGNLADMYAATRAAGFGDEV
KRRIMIGTYVLSAGFYDAYYIKAQKIRALIARDFEAAFDKCDILLTPATPTAAFALGQKQ
EDPIAMYLNDVFTVPASLAGLPAMTVPVGLNEQGLPLGLQLIGKPLDEQSVLNAGLALEE
RAGFTSQPKKWW
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcttacagatcttggtgttacagatttacgcgatggtatcgcaaaaggtgac
ttttcagcgaaagaagtcgctgaaagctttctgactgccaccaacgaagctgaaaagctg
aatgcttttatcacgctcactcctgaccatgctttaaaacaggctgaaaaggctgacaaa
gaccgcgcctccggccagttaaaaccgttatccggtgtgccgctcggtatcaaagacctg
ttttgcaccaacggctatcgcaccactgcggccagcaaaattatcgacaattttgtgccg
ccttatgaatccacgattactgaaaagttattctcggcaggtgccggcatggtcggcaaa
ctgaatcttgaccagtttgctatggggtcttccaatgagaccagcgccttcgggaacgtc
atttctccttggcggcaaaagggcgatgacacggccttaacgccgggcggttcttccggt
ggttcggcagcagccgtcgccgctaaactcgttccggccgccaccggcaccgataccggc
ggctccatccgtcagcccgcttctttcaccggcatcacgggcttaaagccgacctatggc
cgttgctcccgttacggggttatcgcctttgcctcctcgctcgatcaggcaggtcccatg
gctcattctgtcaaggattgcgccgctttactggaagtcatggcgggttttgatcccaaa
gattccacttctgtcgatgtgatggtgccgaattgggaaaaactgctttcctctgacatt
cgcggcaaaaaaatcggtattccgaaagaatatcgcgtggatggcatggcgcccgaaatc
gaaagtttatggcagcgtggcatcgacatgatgaaggatgcgggtgccgaaattattgat
gtaagcctaccccatacgcaacatgctttggcggcttattatatcattgctccggcggaa
gcctcctctaacctcgcccgttacgacggtgttcgctatggtgaacgcaaaacgccggaa
gggggcaatctcgcggatatgtatgccgcgaccagagcggctggtttcggtgacgaagtc
aaacgccggattatgatcggtacctatgtgctgtctgccggtttctatgatgcctattat
atcaaggcacagaaaatccgtgctttaattgcccgcgattttgaagccgcttttgacaaa
tgcgatattctgctgactcctgcaacgccaacggctgcctttgcccttggtcaaaagcaa
gaagatcccatcgcgatgtatctgaacgatgtcttcacagttccggcttctttggcgggt
ctccctgcaatgacagtgccggttggccttaatgaacagggtctgccgcttggtttgcag
ttgatcggcaagcctttggatgaacagagcgtgttaaatgctggccttgctctcgaagag
cgcgccggatttaccagccagccaaagaaatggtggtaa

DBGET integrated database retrieval system