KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_1033Help
Entry
Za10_1033         CDS       T01110                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
zmn00030  Pentose phosphate pathway
zmn01100  Metabolic pathways
zmn01110  Biosynthesis of secondary metabolites
zmn01120  Microbial metabolism in diverse environments
zmn01130  Biosynthesis of antibiotics
zmn01200  Carbon metabolism
zmn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Za10_1033
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Za10_1033
Enzymes [BR:zmn01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Za10_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ACV75578
LinkDB All DBs
Position
complement(1208290..1210281)
Genome map
AA seq 663 aa AA seqDB search
MSVPYRHLANAIRALSMDAIQAANSGHPGLPMGMADVATILFGRYLKFNPKDPTWPDRDR
FVLSGGHGCMLLYSLLYLTGYDEPSLEDIKNFRQLGSRCAGHPENTLLSGVEATTGPLGQ
GIGMAAGMALAERHLKAQFGEDIVNHRVWTIAGDGCLMEGINHEVVGIAARLGLGNLNVL
WDDNGITIDGDVTISRKEDVMARHRACGWHVVACDGHNTESIIKAMDEAIADPRPSLIAC
RTTIGYGSPGKQGTAAAHGTPLGEEEILLTREALEWTSPDFTVPHHILKKWKELGTRHLD
EYHAWKERLEANKDKDEFLRITKGQLPQDFDLTDHKNNIISSAMPMATRKASEMALSVLI
RQLPELVGGSADLTPSNNTKPKGMTTLSSADYGGRYIHYGIREFGMATVMNGLALHGGVI
PYGGTFLAFSDYSRPAIRLSALQKTRVVYVMTHDSIGVGEDGPTHQPIEQVMSLRLIPNL
RVFRPADSVETAECWELALKNIDGPSLIVLSRQNLPLLRESADENLSARGAYRLRSAVAK
RRVILMATGSEVSLAVEVADLLETAGFGADVVSMPSWTLFDQQPESYRNDVLPDQPQSTI
LRVSIEAGTTIGWERYTGINGLRYGIDVFGASAPANDLYAHFGLTAVGITNKVLAAIAGK
SAR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttccgtatcgacacctcgctaatgccattcgtgccttgtcgatggatgctatc
caggccgctaatagcgggcatccggggttgccgatgggtatggcagatgtcgcaaccatc
ctctttgggcgctatttaaaatttaaccccaaagatccgacatggccggatcgtgaccgc
tttgtcttgtccggtggtcatggatgtatgctgctttattccctgttatatttgactgga
tatgatgaacctagcttagaggacatcaagaatttccggcagctgggtagccgttgcgcg
ggtcatcctgaaaatactttgctgtcaggggttgaagcaactacgggccctctgggacag
ggaatcgggatggcggctggaatggccttggctgaacgtcatttgaaggctcaattcggt
gaagatatcgttaatcaccgtgtttggaccattgccggtgacggatgcctgatggaaggt
attaaccatgaagttgttgggattgcggctagactgggcttaggaaatcttaatgttttg
tgggatgataacggtatcaccatcgatggtgacgttactatttcacgcaaagaagacgtg
atggcgcgtcatcgtgcctgtggttggcatgttgtggcttgtgatggtcataatacagaa
tccattatcaaggccatggatgaagctattgccgatcctagaccttccttgatcgcttgc
cgcacaacgattggttatggttccccaggaaaacaggggacggcggctgctcatggaacg
ccattaggggaagaagaaattctgttgacccgtgaggctttggaatggactagccctgac
tttactgtcccccatcacatcctaaaaaaatggaaagaactgggcacgcgtcatcttgac
gaatatcatgcatggaaagagcgccttgaggcgaataaagataaagacgaatttttgcgg
atcactaaggggcagttgccgcaagattttgatctgacagaccataagaacaatatcatc
agctcggctatgccgatggcaactcgtaaagcctcggaaatggctttgagcgtcctgatt
cgccagttaccggaattggttggcggttcggctgatcttacgccgtctaataataccaag
cccaagggcatgacgaccctatcgtcagctgattatggcggtcgctacatccattacggt
attcgtgaattcgggatggcgacggtgatgaatggtctggcccttcatggtggggttatt
ccttatggcggcactttccttgctttttctgattatagccgccctgcaatccgactgtcg
gctttgcaaaagacaagggtcgtctatgtcatgacccatgattcgattggtgttggggaa
gatggcccgactcatcagccgattgaacaagttatgtctttgcgtttgattcctaattta
agagttttccggcctgctgattcggttgaaacggcagaatgttgggaactggccttgaaa
aatattgatggcccttcattaatagttttgtcccgtcagaatttaccgttgctacgcgaa
tcggcggatgaaaatctttcggcgcgcggggcttatcgtctccggtcggctgttgccaaa
aggcgggttattttgatggcaacaggatcagaggtttccttagctgttgaggtcgcagac
ctcctagaaacagcaggttttggggcagatgtcgtgtcgatgccgagttggactttgttc
gatcaacaacccgaatcctatcgtaatgatgttttgcccgatcagcctcaatcgacaatt
ttacgcgtttcgatcgaagcagggacgacaattggctgggaacggtatactggaataaat
ggtcttcgttatggtattgatgtttttggtgcatcggccccggcgaatgatctatatgct
catttcggcttgaccgcagtcggcatcacgaacaaggtgttggccgcgatcgccggtaag
tcggcacgttaa

DBGET integrated database retrieval system