KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0834Help
Entry
ZMO0834           CDS       T00221                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00473  D-Alanine metabolism
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
zmo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ZMO0834
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO0834
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ZMO0834
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO0834
Enzymes [BR:zmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ZMO0834
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Precursor biosynthesis
  Amino acid ligase
   ZMO0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding
Motif
Other DBs
NCBI-ProteinID: AAV89458
UniProt: Q9RNM9
LinkDB All DBs
Position
838096..839061
Genome map
AA seq 321 aa AA seqDB search
MSDKKHVVVLMGGWSSEREISLLSGRHVGKALEEAGYRVTLLDMDRDIAFKLREAKPDVV
FNALHGTPGEDGSIQGLMDLMAIRYTHSGLTASAIAIDKELTKKILTPENIPMPQGCLVE
RESLYTKDPLPRPYVLKPVNEGSSVGVAIIDESFNDGQPIRKDQIDPWKNFKTLLAEPFI
KGRELTVAVMGDKALAVTELCPNNGFYDYKAKYTDGMTTHICPAKIPAEIAEKAMALSLK
AHQLLGCRGPSRSDFRWDDEAGLDGLFLLEVNTQPGMTPLSLVPEQAKQLGIDYVALCRM
IVEEALAEDTLQETKMAGQGG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaaaaagcatgttgtcgttttgatgggcggatggtcttcggaacgtgaaatt
tcgcttctgtcaggccgccatgtcggcaaggctttggaagaggctggatatcgggttacg
ctgctcgatatggatcgggatattgcgttcaagcttcgtgaagctaagccggatgtggtt
tttaatgctttgcatggcacgccgggtgaagatggcagtattcaaggtctgatggattta
atggctatccgttatacccattcgggtttgacggcttcggccattgccattgataaagaa
ttgaccaaaaagattctgacccctgagaatattccgatgccgcagggctgtttggttgag
cgcgaaagcctttatacaaaagacccgttgccacgaccttatgtcttgaaaccggtcaat
gaaggctcttctgtcggcgttgcgatcattgatgaatcttttaatgacggtcagcctatt
cggaaagaccagattgatccgtggaaaaattttaaaacccttcttgccgaaccttttatt
aaagggcgggaattaaccgtagcggtgatgggtgacaaagccttggctgttaccgaatta
tgcccgaataacggcttttacgattataaagccaaatatactgatggcatgacaacccat
atctgtcctgcaaaaattccggcagagattgccgaaaaggcgatggctctttccttgaaa
gcgcatcaacttttgggatgtcggggcccgtcgcgttccgattttcgttgggatgatgaa
gccggattggatggtttgtttctgttagaggtgaatacccagccgggtatgacacctttg
agtttggttcctgaacaggcaaaacagctgggtatcgactatgtcgccttgtgccggatg
attgttgaggaagccttggcggaagacacattacaagaaaccaaaatggcaggacagggt
ggctaa

DBGET integrated database retrieval system