KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1177Help
Entry
ZMO1177           CDS       T00221                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AAV89801
UniProt: H2VFM2
LinkDB All DBs
Position
complement(1195959..1196684)
Genome map
AA seq 241 aa AA seqDB search
MASQTIMIVEDDASLRALIARVLKENGYIPCPVGSGEEMWEELQSRTVDLILMDVMLPGK
NGLDLTRELRSNSQYMAIPVIFLSARDDETDRVVGLELGGDDYIPKPFGKKELVARVRAV
LRRSQAVKEADGNPQSHLIHFEGWVLDPDRRELHSPTGAGVELSGAEFDLLLSFLQHAQR
VIGRERLLELSRSRLSEASDRSIDVLVSRLRRKLSSQTEAGDMIRTIRGVGYMFTVPVSQ
D
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccagacgattatgatcgtcgaagacgatgcttctttacgagcgttaattgct
cgcgtgctgaaagagaatggctacataccttgtccagtaggctctggcgaagaaatgtgg
gaagagttacaaagccgaacggtcgatcttattttaatggatgtcatgctgcctggtaaa
aacgggttggatctaacgcgcgaattacgcagcaatagccaatatatggcaattccggtt
attttcttgagtgcgcgcgatgacgaaactgatcgagttgtcggattagaactgggtggg
gatgattatatcccgaagccttttggtaaaaaagaattggtagcaagagttcgtgccgtt
ttgcgacgcagtcaagcggttaaagaagcggatgggaatccacaaagtcaccttattcat
tttgaaggctgggtacttgaccctgaccgccgtgaacttcattctccgacaggggctggc
gtcgaattgtcaggtgccgaatttgatctgctcttatcctttttacaacatgcacaacga
gtgatcgggcgcgaaaggctgttagaattatctcgcagtcggctaagcgaggcttctgac
cgaagtattgatgttttagtcagtcgattgcgtcgtaaactgtctagccaaacagaggct
ggtgacatgatacgcaccattcgcggggtcggctatatgtttacagtaccggtttctcag
gattga

DBGET integrated database retrieval system