KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0467Help
Entry
Zymop_0467        CDS       T01556                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00970  Aminoacyl-tRNA biosynthesis
zmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Zymop_0467
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:zmp03029]
    Zymop_0467
Enzymes [BR:zmp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Zymop_0467
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Zymop_0467
Mitochondrial biogenesis [BR:zmp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Zymop_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEI37370
UniProt: F8EVG3
LinkDB All DBs
Position
539327..540805
Genome map
AA seq 492 aa AA seqDB search
MAHITDLGVTELRDGIAKGDFSAREVAENFIAATDAGKSLNSFITLTPDHALAKADEADK
ARVAGTLKPLSGVPLGIKDLFCTNGYRTTAASKILDNFIPPYESSITEKLFSAGAGMIGK
LNLDQFAMGSSNETSAFGNVISPWKRKGDNVDITPGGSSGGSAAAVSARLIPAATGTDTG
GSIRQPASFTGIAGIKPTYGRCSRYGVIAFASSLDQAGPMARSVKDCAALLEVMAGFDPK
DSTSIDVAVPDWEKLLSSDLKGKTIGIPKEYRVDGMADEIEKLWQHGIKMMQDAGAKIVE
VSLPHTHYALSAYYIIAPAEASSNLARYDGVRYGERVTPENGNLVDMYSATRAAGFGYEV
KRRIMIGTYVLSAGFYDAYYIKAQKVRALIARDFETAFQKCDLLLTPATPTAAFGLGEKQ
DDPLSMYLNDVFTVPASLAGLPAMTVPVGLNEKGLPLGLQLIGKPLDEQGVLNAGLALEE
RAGFTSLPEKWW
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcccatattactgatctcggtgttaccgaattacgcgatggtatcgcaaagggcgat
ttttctgcccgagaagtcgctgaaaatttcattgcagcgaccgatgcaggaaaatcgctg
aatagctttattacccttacccccgatcatgcccttgcaaaagcggatgaagctgacaaa
gcgcgtgtcgctggcacattaaaaccgttatcgggtgtgcccttgggtattaaagatttg
ttttgcacaaatggctatcgtaccactgccgcaagtaaaattttagataatttcattccg
ccttatgaatccagtatcactgaaaagctgttttctgcgggagctggtatgatcggcaaa
ctgaatcttgatcagttcgctatgggatcatccaacgaaaccagcgcttttggcaatgtc
atttcgccatggaaaagaaaaggggataacgtcgatattactcccggcggatcatcgggt
ggatcggcggcggcggtttctgccagattaattcctgctgcaacgggtaccgatacgggt
ggttctattcgtcagccagcatcctttacaggtattgccggaatcaagccgacttatggt
cgctgttcccgctatggtgttattgcctttgcttcttctttggatcaggcaggtcccatg
gcgcgttcggtgaaagactgtgccgctttactagaagtgatggcgggttttgatcccaaa
gattctacctcaatcgacgtagccgttcctgattgggaaaaactgctttcttccgatctt
aaaggtaaaaccattggtattccaaaagaatatcgggtggatggtatggccgacgaaatc
gagaagctttggcagcatggtattaaaatgatgcaggatgccggtgccaagattgtagaa
gtatctctgccccatactcattatgccttgtctgcctattatattattgctccagcagaa
gcttcttccaatcttgcccgttatgatggagtgcgttacggagaacgcgtaacgcctgaa
aatggcaatcttgttgatatgtattcagctacccgcgcggcaggtttcgggtatgaagtg
aaacgtcggattatgattggcacctatgtgctatctgccggtttttatgatgcgtattat
attaaagcccaaaaagtccgcgcgctgattgctcgtgattttgaaactgcttttcaaaaa
tgtgatcttttgttgacccctgccacgccaacggccgcttttggtttgggtgaaaaacag
gatgatcctttgtccatgtatttaaatgacgtctttaccgttccggcttcattagcaggc
ttaccggcaatgacggtacctgttggtctgaatgaaaaaggtttaccccttggtctacaa
ttgatcggcaagcctttagacgaacagggtgttttaaatgccggtctcgctttagaagaa
cgggccggattcaccagcctgccggagaaatggtggtaa

DBGET integrated database retrieval system