KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0708Help
Entry
Zymop_0708        CDS       T01556                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00010  Glycolysis / Gluconeogenesis
zmp00020  Citrate cycle (TCA cycle)
zmp00620  Pyruvate metabolism
zmp01100  Metabolic pathways
zmp01110  Biosynthesis of secondary metabolites
zmp01120  Microbial metabolism in diverse environments
zmp01130  Biosynthesis of antibiotics
zmp01200  Carbon metabolism
Module
zmp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Zymop_0708
   00020 Citrate cycle (TCA cycle)
    Zymop_0708
   00620 Pyruvate metabolism
    Zymop_0708
Enzymes [BR:zmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Zymop_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N Peptidase_M23 HlyD_3 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AEI37610
UniProt: F8ES35
LinkDB All DBs
Position
complement(806494..807795)
Genome map
AA seq 433 aa AA seqDB search
MSIEVKMPALSPTMTEGTLAKWLVKEGDTVKAGDILAEIETDKAIMEFETVDAGIIAKIL
VPEGTENVAVGQVIAVMAEAGEDVKSVADSAKSAAESSPAQEKAEASDGALSMDAALEKA
ISNAKQAADSPIFQNSENLPAPNRIKASPLAKRLAKNNNVDLSKISGTGPHGRIVKADID
AFIRQSSPISSPNITVSGEALKHATPHETVKLSNMRRVIARRLTESKQTIPHIYLTVDVK
LDALLALRSELNEVFSEKNIKISVNDMLIKAQALALRAVPKVNVGFDGDQMLQFSRADIS
VAVSIPGGLITPILKNADGKKLSDLSVEMKDLIARAREGRLQPEDYQGGTASLSNMGMFA
IKQFSAVINPPQASILAIGAGEKRPCVVDDEISIATLATVTGSFDHRVIDGADGAVFMST
FKRLIEKPLGILA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaagtcaagatgccagcgctttcgcctacaatgacagaaggcacgcttgct
aaatggttagttaaagagggagataccgttaaagcaggcgatattctggccgaaatcgaa
actgataaagccatcatggaatttgaaaccgttgatgctggcattattgctaaaatttta
gtgccagaaggcaccgaaaatgttgccgtcggtcaggtcattgcggttatggctgaagcg
ggagaggatgtgaaatccgtagcagattcggcaaagtccgctgcagaatcatcccctgcc
caagaaaaagcagaagcgtcagacggggcactttctatggatgccgctcttgaaaaagca
atcagtaatgcaaagcaagcggctgattcgcctatttttcaaaattcagaaaatctaccc
gcgcctaatcggataaaagctagtccattagctaaacgtctggctaaaaataataatgta
gatttatcaaaaatatccggtaccggcccgcatggacgaatcgtcaaggctgatattgac
gcttttatccgccaatcttctcccatatcttcgcccaatattactgtttctggtgaggcg
ttgaagcatgctacaccgcatgagacggttaaactatccaatatgcgacgtgttattgcc
cgccgtttgacagaatcaaaacaaactattccgcatatttatttaaccgttgatgttaaa
cttgatgcacttttagccctgcgatcagaattaaatgaggttttttctgagaaaaatatt
aaaatctctgtcaatgatatgctgattaaagcacaagccttagctttaagagccgtccca
aaagtcaatgtcggctttgatggcgatcagatgttgcaattttcgcgtgccgatatttcc
gtggcagtgtctattcctgggggattgattacccccattttaaaaaatgcggatggtaaa
aaactgtctgatctttcagttgaaatgaaagatctgatagcccgtgcccgtgaaggtcgt
ttgcaacctgaagattatcaagggggtaccgcaagcctttcaaatatgggtatgtttgct
attaaacaattcagtgctgttataaatccaccgcaagcttctatcttagctattggggct
ggtgaaaaacggccttgtgttgtcgatgatgaaattagcatagctacgctggctacggtg
acaggtagttttgatcatcgcgttattgatggtgctgatggtgctgttttcatgtcgact
tttaaacgcttgattgaaaaacccttggggattttggcataa

DBGET integrated database retrieval system