KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_1423Help
Entry
Zymop_1423        CDS       T01556                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmp01100  Metabolic pathways
zmp01110  Biosynthesis of secondary metabolites
zmp01130  Biosynthesis of antibiotics
zmp01230  Biosynthesis of amino acids
Module
zmp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:zmp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Zymop_1423
Enzymes [BR:zmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     Zymop_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AEI38313
UniProt: F8EV95
LinkDB All DBs
Position
complement(1656048..1657124)
Genome map
AA seq 358 aa AA seqDB search
MSFNSFGHLFRFTSWGESHGPALGAVVDGCPPGLTLSEEDIQPWLDRRKPGSSRFTTQRR
EPDKVQILSGVFEGKTTGTPISLMIENTDQRSRDYSEVARQYRPAHGDFAYDAKYGLRDY
RGGGRSSARETAARVAAGAVARLVIPEVNIQGYLVELGGDAIDRTRFDKAEIGNNPFFCP
DAEAVKRWEIIVDKARKDGNSVGAIVECVATSVPAGWGAPLYAKLDAELAAACMGINAVK
AVEIGDGFTAARSNGRDNADAIRPDEQDGKAFFLSNHAGGITAGIATGQPIVLRCALKPT
PSILSPLQSIDREGYAVEVSTKGRHDPCVGIRAVPVVEAMVALVLADQKLLHRGQTGR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaatagttttggtcatctttttcgttttaccagttggggtgaaagtcatggg
ccagccttaggcgcagtagtcgatggctgtcctccgggtttgaccttgtccgaagaagat
attcaaccttggcttgatcgacgaaaaccgggatcttcccgttttaccacacaaagacgt
gaaccagataaggttcagatattatcaggtgtttttgaaggtaaaacgacaggcacgccg
atcagcttaatgattgaaaatacagatcagcgatcccgtgattatagcgaggtggcgcgc
caatatcgtcctgcgcatggcgactttgcctatgatgccaaatatggcttacgagactat
cgtggtggagggcgatcttctgcacgtgagacagcagcacgcgtcgcagcaggggctgtt
gcccgcttggttattcctgaagtcaatattcaaggttatctggtcgaattagggggcgat
gccatcgaccggacacggtttgacaaggcagaaattggaaataatccgtttttttgtcct
gatgccgaggctgtaaaacgatgggaaattattgttgataaggctcgaaaggatggaaac
tcagtgggtgcaatcgtggaatgtgttgctacctcggtgccagccggttggggtgccccc
ctttatgccaagcttgatgctgagctggcggcggcctgtatgggtatcaacgccgtaaaa
gcggtcgagattggggatggctttactgcagcgcgtagtaatggtcgtgacaatgcggat
gcaattcgccccgatgaacaagacggaaaagccttttttctctctaatcatgcgggcggc
atcacagcaggcattgcgacagggcaacccatcgtcctgcgatgcgctttaaagccgaca
ccatctatcttatctccccttcaatcgattgatcgcgaaggctatgcggtagaagtaagc
actaaaggccgacatgatccttgtgtgggtattcgggctgtaccggtcgtagaagcaatg
gtcgctttggtcttagccgatcaaaagctgcttcatcgagggcagacaggacgctag

DBGET integrated database retrieval system