KEGG   Zymomonas mobilis subsp. mobilis NRRL B-12526: A254_00211Help
Entry
A254_00211        CDS       T03160                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
zmr  Zymomonas mobilis subsp. mobilis NRRL B-12526
Pathway
zmr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:zmr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A254_00211
Enzymes [BR:zmr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A254_00211
Transporters [BR:zmr02000]
 Other Transporters
  Pores ion channels [TC:1]
   A254_00211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4 DUF5118
Motif
Other DBs
NCBI-ProteinID: AHJ69850
LinkDB All DBs
Position
complement(237525..238196)
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKVRFLLGEKGIGYELIRESPWLKRDEFVDMNPAGQTPVMVDSSAPV
ILVDSQVICEFLEETVDRMPLISGTAVHRAEIRRLVSLFDNKLYFEVTAPLMNERMLKRL
VHRQAPDAAILRSAMKNANSHLDYIDWLLDHRRWLAGPVLSLADFAAAAQISVSDYLGGV
DWRGHENSREWYAAMKSRPSFQPILAERMEVILPPDHYDQPDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctttatcagtttcctctttgccctttttcccgaaaggtgcgttttctcctt
ggtgaaaaagggatcggctatgagttgatccgtgaatccccatggctaaaaagagatgaa
ttcgtcgatatgaatccagccggtcaaacgccggttatggtagatagttctgcgcctgtt
attctggtggattcacaggttatctgtgaatttctggaagaaacagtcgatcggatgccg
cttatcagcggaacagccgtgcatagggctgaaataaggcgtttggtttctctctttgat
aacaaactttattttgaagtcaccgcgcctttaatgaatgagcggatgctgaaaaggctg
gttcatcgtcaggcaccggatgctgcaattttgcggagtgccatgaaaaacgccaatagc
catctcgattatattgattggttattggatcatcgtcgttggttggcggggcctgtttta
agtttggcggattttgcggcggcagcacaaatttcggtttccgattatcttggtggcgtt
gattggcgcggtcacgaaaatagtcgcgaatggtatgcggcaatgaagtcccgcccctct
ttccaacctattttagcagagagaatggaggttattttgcctccagatcattacgaccag
ccagatttctaa

DBGET integrated database retrieval system