KEGG   Zymomonas mobilis subsp. mobilis NRRL B-12526: A254_00919Help
Entry
A254_00919        CDS       T03160                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
zmr  Zymomonas mobilis subsp. mobilis NRRL B-12526
Pathway
zmr00220  Arginine biosynthesis
zmr00250  Alanine, aspartate and glutamate metabolism
zmr00270  Cysteine and methionine metabolism
zmr00330  Arginine and proline metabolism
zmr00350  Tyrosine metabolism
zmr00360  Phenylalanine metabolism
zmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmr00401  Novobiocin biosynthesis
zmr01100  Metabolic pathways
zmr01110  Biosynthesis of secondary metabolites
zmr01130  Biosynthesis of antibiotics
zmr01210  2-Oxocarboxylic acid metabolism
zmr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A254_00919
   00270 Cysteine and methionine metabolism
    A254_00919
   00220 Arginine biosynthesis
    A254_00919
   00330 Arginine and proline metabolism
    A254_00919
   00350 Tyrosine metabolism
    A254_00919
   00360 Phenylalanine metabolism
    A254_00919
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A254_00919
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    A254_00919
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmr01007]
    A254_00919
Enzymes [BR:zmr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     A254_00919
Amino acid related enzymes [BR:zmr01007]
 Aminotransferase (transaminase)
  Class I
   A254_00919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_MocR Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHJ70534
UniProt: A0A2R9NVC3
LinkDB All DBs
Position
1034764..1035966
Genome map
AA seq 400 aa AA seqDB search
MVHISAALSRIQPSPTIAVTSRVIELKSKGVDIITLGAGEPDFETPEFIKEAAIQAIHDG
KTRYTNVDGTAELKEAIVGKFRRDNHLEYRTDQISVGSGGKHVLFNALTATIDQGDEVII
PAPYWVSYPDIVRFCGGTPVFIQATIDQDYKITAEQLEKAITPKTRWFIFNSPSNPTGAA
YSADEIKSLAEVLRRHPHVWILSDDIYEHIVFDNFRFATIAEVAPDLFDRTLTANGCSKA
YAMTGWRIGFAGGPTPLIKAMAKLQSQSTSNPCSISQAAAVAALNGPQDFLQGWSDDFAR
RRNLVVDGLNAIEGISCPKPQGAFYVYPGISELIGKKTPSGKVIEKDLDFSSYLIDEAKV
AVVHGEAFGLSPAFRISYATSTELLKKALERISDAVARLK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggttcacatttccgctgccctttcccgtatccagccttccccgaccattgccgtgacc
agtcgagtgatcgagctcaaatcaaaaggggtcgatattattacactcggggcaggtgaa
ccggatttcgaaacccccgaatttattaaagaagccgctatccaagccatccatgatggg
aaaacccgttataccaatgttgatgggacggcagaattaaaagaagccatcgttggaaaa
ttccgccgcgacaaccatcttgaatatcggacagatcagatatccgtcggttccggcggc
aagcatgtgttgttcaatgctctgacggcgacgattgaccaaggcgatgaagtcattatc
cctgccccttattgggtcagctatcctgatatcgtgcgtttttgtggtgggacgccagtc
ttcattcaggccactattgaccaagattacaaaatcaccgccgaacagcttgaaaaagcc
attacgccaaaaacgcgctggtttatctttaactctcccagcaacccgactggtgccgcc
tatagcgcggatgaaatcaaaagcctcgccgaagttttacgtcggcatcctcatgtctgg
attttgtcagatgatatttatgaacatatcgtcttcgacaatttccgctttgcaaccatc
gccgaagtagcaccggatctcttcgatcgcactttgaccgcgaatggctgttcaaaagcc
tatgccatgaccggatggcgtatcggttttgccggtggccccaccccacttatcaaagcc
atggccaagctccagtcacaatcaacctccaatccatgctcaatttcacaggcggccgct
gttgctgctctgaacgggccacaggatttcttgcaaggctggtctgacgattttgcgcgc
cgccgcaatctggtggttgatggtctgaatgcgattgaaggtatttcctgcccgaaaccg
caaggtgccttctatgtctatccgggcatttccgagcttattggcaagaaaaccccatca
ggcaaagtcattgaaaaagacttggatttctcaagctatctgattgacgaagccaaagtg
gctgttgtccatggggaagccttcggtctgtcacccgctttcagaattagctatgcgacc
tcaaccgaattactgaaaaaagcgcttgaacgcattagcgatgctgtcgcccgcctaaaa
taa

DBGET integrated database retrieval system