KEGG   Zymomonas mobilis subsp. mobilis NRRL B-12526: A254_01649Help
Entry
A254_01649        CDS       T03160                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zmr  Zymomonas mobilis subsp. mobilis NRRL B-12526
Pathway
zmr00620  Pyruvate metabolism
zmr00680  Methane metabolism
zmr01100  Metabolic pathways
zmr01120  Microbial metabolism in diverse environments
zmr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A254_01649 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    A254_01649 (ppc)
Enzymes [BR:zmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A254_01649 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHJ71234
UniProt: A0A2R9NX98
LinkDB All DBs
Position
complement(1872783..1875440)
Genome map
AA seq 885 aa AA seqDB search
MTKPRTINQNPDLRYFGNLLGQVIKEQGGESLFNQIEQIRSAAIRRHRGIVDSTELSSRL
ADLDLNDMFSFAHAFLLFSMLANLADDRQGDALDPDANMASALKDIKAKGVSQQAIIDMI
DKACIVPVLTAHPTEVRRKSMLDHYNRIAGLMRLKDAGQTVTEDGLPIEDALIQQITILW
QTRPLMLQKLTVADEIETALSFLRETFLPVLPQLYAEWEKLLGSSIPSFIRPGNWIGGDR
DGNPNVNADTIMLSLKRSSETVLTDYLNRLDKLLSNLSVSTDMVSVSDDILRLADKSGDD
AAIRADEPYRRALNGIYDRLAATYRQIAGRNPSRPALRSAEAYKQPQELLADLKTLAEGL
GKLAEGSFKALIRSVETFGFHLATLDLRQNSQVHERVVNELLRTAAVEADYLSLSEEDRV
KLLRRELSQPRTLFVPRADYSEETRSELDIIQAAARAHEIFGPESITTYLISNGESISDI
LEVYLLLKEAGLYQGGAKPKAAIEAAPLFETVADLENAPKVMEEWFKLPEAQAIAKAHGV
QEVMVGYSDSNKDGGYLTSVWGLYKACLALVPIFEKAGVPIQFFHGRGGSVGRGGGSNFN
AILSQPAGAVKGRIRYTEQGEVVAAKYGTHESAIAHLDEAVAATLITSLEAPTIVEPEFS
RYRKALDQISDSAFQTYRQLVYGTKGFRKFFSEFTPLPEIALLKIGSRPPSRKKSDRIED
LRAIPWVFSWSQVRVMLPGWFGFGQALYDFEDTELLQEMASRWPFFRTTIRNMEQVMARS
DMTIAKHYLALVEDQTNGEAIYDSIADGWNKGCEGLLKATQQNWLLERFPAVDNSVQMRR
PYLEPLNYLQVELLKKWRGGDTNPHILESIQLTINAIATALRNSG
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagccgcgcacaattaatcagaacccagaccttcgctattttggtaacctgctc
ggtcaggttattaaggaacaaggcggagagtctttattcaaccagatcgagcaaattcgc
tctgccgcgattagacgccatcggggtattgttgacagcaccgagctaagttctcgctta
gccgatcttgaccttaatgacatgttctcttttgcacatgcctttttgctgttttcaatg
ctggccaatttggccgatgatcgtcagggagatgcccttgatcctgacgccaatatggca
agtgctcttaaggacataaaagccaaaggcgtcagtcagcaggcgatcattgatatgatc
gacaaagcctgcattgtgcctgttctgacagcacatccgaccgaagtccgtcggaaaagt
atgcttgaccattataatcgcattgcaggtttaatgcggttaaaagatgctggacaaacg
gtgaccgaagatggtcttccgatcgaagatgcgttaatccagcaaatcacgatattatgg
cagactcgtccgctcatgctgcaaaagctgaccgtagccgatgaaatcgaaactgctctg
tctttcttaagagaaacttttctgcctgttctgccccagctttatgcagaatgggaaaaa
ttgcttggtagttctattccaagctttatcagacctggtaattggattggtggtgaccgt
gacggtaaccccaatgtcaatgccgatacgatcatgctgtctttgaagcgcagctcggaa
acggtattgacggattatctcaaccgtcttgataaactgctttccaatctttcggtctca
accgatatggtttcggtatccgatgatattctacgtctagccgataaaagtggtgacgat
gctgcgatccgtgcggatgagccttatcgtcgtgccttaaatggtatttatgaccgttta
gccgctacctatcgtcagatcgccggtcgcaacccttcgcgtcctgccttgcgttctgca
gaagcctataaacagcctcaagaattgctggctgatttgaaaaccttggccgaaggcttg
ggtaaattggcagaaggtagttttaaggcattgatccgttcggttgaaacctttggtttc
catttggctaccctcgatctgcgtcagaattcgcaggttcatgaaagagttgtcaatgaa
ctgctacggacagccgccgttgaagccgattatttatctctatcggaagaagatcgcgtt
aagctgttaagacgggaattgtcgcagccgcggactctattcgttccgcgcgccgattat
tccgaagagacgcgttctgaacttgatattattcaggcagcggcacgcgctcatgaaatt
tttggccctgaatccattacgacttatttgatttcgaatggcgaaagcatttccgatatt
ctggaagtctatttgcttttgaaagaagcagggctgtatcaagggggtgccaagccaaaa
gcggcgattgaagctgcgcctttattcgagacggtggccgatcttgaaaatgcgccaaag
gtcatggaggaatggttcaagctgcctgaagcgcaagccattgcaaaggcacatggcgtt
caggaagtgatggttggctattctgactccaataaggacggcggatatctgacctcggtt
tggggtctttataaggcttgcctcgctttggtgccgatttttgaaaaagccggtgtgccg
atccagtttttccatggacggggtggttccgttggtcgcggtggtggttccaactttaat
gccattctgtcgcagccagccggagccgtcaaagggcgtatccgttatacagaacagggt
gaagtcgtggcggccaaatatggcacccatgaaagcgctattgcccatctggatgaggcc
gtagcggcaactttgattacgtctttggaagcaccgaccattgtcgagccagagtttagt
cgttaccgtaaggccttggatcagatctcagattcagctttccagacctatcgccaattg
gtctatggaacgaagggcttccgtaaattctttagtgaatttacgcctttgccggaaatt
gccctgttaaagatcgggtcacgcccacctagccgcaaaaaatccgaccggattgaagat
ctacgcgctattccttgggtgtttagctggtcacaagttcgggtcatgttacccggttgg
ttcggtttcggtcaggctttatatgactttgaagataccgagctgttacaggaaatggca
agccgttggccgtttttccgcacgactattcgtaatatggaacaggtgatggcacgttcc
gatatgacgatcgccaagcattatctggccttggttgaggatcagacaaatggtgaggct
atctatgattctatcgcggatggctggaataaaggttgtgaaggtctgttaaaggcaacc
cagcagaattggctgttggaacgctttccggcggttgataactcggtgcagatgcgtcgg
ccttatctggaaccgcttaattacttacaggtcgaattgctgaagaaatggcgtggaggt
gataccaacccgcatatcctcgaatctattcagctgacaattaatgccattgcgacggca
cttcgcaacagcggttga

DBGET integrated database retrieval system