KEGG   Zootermopsis nevadensis: 110827117
Entry
110827117         CDS       T05136                                 

Definition
(RefSeq) uncharacterized protein LOC110827117
  KO
K20017  Bcl-2 family protein
Organism
zne  Zootermopsis nevadensis
Pathway
zne04214  Apoptosis - fly
zne04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:zne00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110827117
   04215 Apoptosis - multiple species
    110827117
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 110827117
NCBI-ProteinID: XP_021914180
LinkDB
Position
Unknown
AA seq 317 aa
MTSIAFGLFQQRVGCDTRRFSSAIADSSEGVTGNALPLTSHPLGLPPTAQQRRKFSFPAS
LHSSLLGLTGSAGGETGNAVAGSARRRFSNVSDAVSRKLSNTIGWRTAPIPTQEIIDQGK
SLCGQYIRSRLKRSGVFNRKCGLQRLRTAASLPGGYVVRDVFPELASIGQELERMYPKLY
TSVARQASPSPGGGNLTSEKAAGVVLTAVARELFKVDVTWGKVVSLFAVAGGLAVDCVRQ
GHPEYLHDLLEAMGEVLEEELAAWIVGNGGWAALLSHFKPPSTEVSVTGFLGVLGAVMAT
VVFLVFIARWFGKFAFI
NT seq 954 nt   +upstreamnt  +downstreamnt
atgacatctatcgcgtttgggttgtttcagcaacgcgtcggctgcgacaccaggaggttc
tcatctgcgatcgctgactcatcagaaggcgtcacgggaaacgcgctgcctctgacatcc
caccctctggggttgccaccaaccgcacaacaacgacggaagttcagcttcccggcttca
ctacattccagtctgctaggactcactggatctgctggaggtgaaaccggaaatgcggtt
gctggttctgcaagacgacgttttagtaatgtcagcgatgcagtgtcgcgtaaactgtcg
aataccatcggttggcgtacagcgccgataccaacccaagagataatcgatcaagggaag
tcgttatgcggacagtacatccgtagccgtttgaagcgctcgggtgtttttaataggaaa
tgcggacttcagaggttaaggacagctgctagtttaccggggggatacgttgtgagagat
gtgttcccggagttggccagtataggacaggagttggagagaatgtatcctaaactttat
acctctgtagctaggcaggctagtccgtcgcctggaggcggaaatttaacatctgagaaa
gccgctggcgtcgttctaaccgctgtagcacgcgagttgttcaaggtggacgtgacgtgg
ggtaaagtggtttctttgtttgctgtggcgggaggtttggctgtggactgcgtgcgacag
ggtcatcctgagtatctgcacgacttgctggaagccatgggcgaagtgctagaagaggaa
ttagctgcttggatagtcggtaacggtggctgggctgccttgctgtcacatttcaagcca
cccagcactgaagtgtccgtcacggggttcctgggagtccttggcgctgtcatggcaaca
gtcgtcttccttgtcttcatcgcacgctggttcggaaagttcgccttcatctag

DBGET integrated database retrieval system