KEGG   Zootermopsis nevadensis: 110827262Help
Entry
110827262         CDS       T05136                                 

Definition
(RefSeq) trypsin beta-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
zne  Zootermopsis nevadensis
Pathway
zne04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:zne00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110827262
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:zne01002]
    110827262
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zne04147]
    110827262
Enzymes [BR:zne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     110827262
Peptidases [BR:zne01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110827262
Exosome [BR:zne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110827262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 110827262
NCBI-ProteinID: XP_021914447
LinkDB All DBs
Position
Unknown
AA seq 266 aa AA seqDB search
MARCNQVWARTVTMRLLVLLAALAACGAGVPLTSPRPRLDGRIVGGSTTTIDSFPHQLSL
RYDSSHICGASVISTTWAVTAGHCIVGAASRLSLRAGSTYSNSGGTVHQVSQVIRHASYN
EDTIDYDIALLKVSSAFSLGTNVQPIGLQSSSVSAGTNVVVSGWGTTSEGGSASTTLRQV
TVQIVSDSSCNSAYSSYGGITARMICAGTSNGGKDACQGDSGGPLIANGNLVGIVSWGVG
CARANYPGVYTKVSSLRSWIQTNAGV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcccgttgcaaccaagtttgggctagaactgtcacgatgcgtcttctggttctcttg
gctgcactggctgcgtgtggagcaggtgttcctctcacctccccccggcctagactcgac
ggacgcattgtcggcggttcgacaacaacaatcgacagtttcccccatcagctgtcgctg
aggtatgactcatctcacatctgcggtgcgtcggtaatcagcacgacctgggccgtcact
gcaggtcactgcatcgtcggggccgccagtcggctgtcactacgagcaggctccacttat
tccaactctggtggaacggttcatcaggtgtcccaggtcatcagacacgcatcgtacaac
gaagacactatcgattacgacatcgcacttctcaaggtcagcagcgccttcagcctcggc
accaacgttcaacccatcggattgcagagctcatctgtgtctgctggaaccaatgtcgtg
gtcagcggatggggaaccacttctgagggaggttccgccagcaccactctgcgacaggtg
accgtacaaatagtgagcgactcctcatgtaacagcgcctattcttcatatggaggtatc
actgcacgcatgatttgcgcaggaacctctaatgggggcaaggatgcatgccagggagac
tccggtggcccactgattgccaatggcaatcttgttggtatcgtatcctggggagtagga
tgtgctcgtgccaactatccgggagtttacaccaaagtttcttctctacgcagctggata
caaaccaatgcaggggtctaa

DBGET integrated database retrieval system