KEGG   Zootermopsis nevadensis: 110827844Help
Entry
110827844         CDS       T05136                                 

Definition
(RefSeq) probable maltase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00052  Galactose metabolism
zne00500  Starch and sucrose metabolism
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110827844
   00500 Starch and sucrose metabolism
    110827844
Enzymes [BR:zne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110827844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 110827844
NCBI-ProteinID: XP_021915608
LinkDB All DBs
Position
Unknown
AA seq 238 aa AA seqDB search
IIVADIRVILDFVPNHSSDEHEWFVRSLQREEPFTNYYTWHDGRVDTAGNRIPPNNWQSV
FGGPAWTWRPERNQYYLHQFDPKQPDLNYGNPLVVEEMKNVLRYWLDKGVDGFRVDAVPH
LFEGPIDAPDSETSAPTHLPETYEMVAEWRKVMDEKSVEYGRTKVLMLETYGTINQTMGY
YGTDDAPGGHFPFNFRLITDINKLSTAEDFSRTINEYLDVMTDGRTPNWVVSENDCVT
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ataatcgttgcagacattagagtgattttggacttcgtacctaaccactccagtgacgaa
cacgaatggttcgtgaggtccctccagagggaggaaccatttacgaactattacacgtgg
cacgacgggagagtcgacacggctggaaacaggattccgccaaacaactggcaaagcgtg
tttgggggtccggcctggacatggcgtccggaaagaaaccagtattacctgcaccagttc
gaccccaaacaacccgacctcaactatggaaacccgcttgttgtcgaggaaatgaagaat
gtgctccgttactggctggacaagggcgtggacgggttccgcgttgatgccgttccgcac
ctgttcgaaggacccatagacgcgcctgattcggagacgtcagcccctacgcatctccca
gagacctacgagatggtggccgagtggcggaaagtaatggacgagaaaagcgtcgaatat
ggacggacaaaggtgttaatgctggaaacatacggaactattaaccagacgatgggctat
tatggaacggatgatgctccaggcggacatttcccctttaacttccggttaattacagac
ataaataaattgtcaacagctgaagatttcagcagaactattaacgaatacttggacgtt
atgacggatggacgtacgccaaactgggtggtaagtgagaacgactgtgttacgtag

DBGET integrated database retrieval system