KEGG   Zootermopsis nevadensis: 110828224
Entry
110828224         CDS       T05136                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
zne  Zootermopsis nevadensis
Pathway
zne04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:zne00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    110828224
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 DUF5663 Ras_bdg_2
Other DBs
NCBI-GeneID: 110828224
NCBI-ProteinID: XP_021916431
LinkDB
Position
Unknown
AA seq 523 aa
MAASSNLDGAVGAASESKSFSENGKSSSTPSDDGHSRFGLNMGIGELLQNWGLLNLSPFR
RKPSKPGTPSPLNQSPQKQMQAPSKTSPDVEHIELVQLSNIKVSDALWKNIHSNLAMPGD
VFFTNMPGVITSKPLLQKLEGEQGVCNMDFILMDRRPKTQETKLRNSSTFVWTHEEPVEE
VEGGKGHDFSQAHCNYPTWCDMCGDLLWCLYETSYLRCRYCHYTCHPHCQNLVKLDCRGE
NDGETGGAALPDPELESVEHVVQLEEISNPSLEPLLQEVSSEEDSGLNLRVSHEHLQHLI
TEYNAANPSGPDMTLEEDGSTFRGFIRVHMNLCRPISVVAGTRPPSIYDILKDDETLEKT
LTSFYLPRDTVKALHVTSETTTHEVIKALLKKFKVVDNPRKFALYERHYEQGETAKVKMR
RIAESEKPLVLALRWSREENCNKMFVLQENETGDILWEAFTLPELNNFLRILDREEEEYK
NIVRKKYQFLGSKIQEAMDRLQSVQQRHRVSKVQGVGEGSGGS
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggctgcttcttcaaatctggatggagcagtaggtgcagcttctgagtcaaagagcttc
tcagaaaatgggaagagttcttccactcccagtgatgacggtcattctcgatttgggctg
aatatgggaattggtgaactactgcagaactggggtttactgaaccttagtcccttccgt
cgcaagcctagtaaacctggaacaccatctcccttaaatcagtcaccgcagaaacagatg
caggcccctagtaaaacaagcccagatgtagaacacattgaactggtgcaactctcaaat
atcaaggtttcagatgctttgtggaagaacattcacagtaacctggcaatgcctggtgat
gtgttttttacaaatatgccaggagtgattacatcaaaaccacttctgcagaaacttgaa
ggagagcaaggagtttgtaatatggatttcattctcatggataggcggccaaaaactcaa
gaaactaagctgagaaattcctcaacttttgtttggacacatgaagagccggtggaggaa
gtggaaggaggcaaaggacatgatttctcccaggcacactgcaactatccaacatggtgt
gacatgtgtggtgatctactttggtgcttatatgagaccagctacttgcgctgcagatac
tgtcattatacctgtcatcctcattgtcaaaatttggtaaagcttgactgccgtggcgaa
aatgatggcgaaacaggaggtgccgctttaccagatccagaattggaaagtgtggaacat
gtggttcagcttgaggagatttccaatccaagtctagaacctttacttcaggaagtttct
tcagaggaggattctggattaaacttgagagttagccacgaacatctacaacatctaatc
acggaatataatgctgccaacccttcaggtcctgatatgacattggaagaagatggctcc
acattccgagggtttatccgagtacacatgaatttgtgtcggccaatcagtgttgtggct
ggtacacgcccaccttccatttatgatattcttaaagatgatgaaactctggagaaaacc
cttacatctttctatctaccacgtgatacagtgaaggctcttcatgttacaagtgaaaca
accacacatgaagtgatcaaagcacttctaaagaaattcaaggtggttgacaatccccgg
aaatttgctttgtatgaacggcactatgaacaaggagaaactgcaaaagtcaaaatgcgt
cgaatcgctgaaagtgaaaagccacttgttcttgcacttcgatggagtagagaagaaaat
tgcaacaagatgtttgtccttcaggaaaatgaaactggtgacatattgtgggaagcattt
actctgccagaactgaacaactttttgcgcatcctggaccgggaagaagaggagtacaag
aatattgtgcgaaagaaatatcagtttttgggaagtaaaattcaggaagcaatggataga
ctgcagtcagtacaacagcggcaccgggtctcaaaggttcaaggggttggggaaggaagt
gggggctcttga

DBGET integrated database retrieval system