KEGG   Zootermopsis nevadensis: 110828947Help
Entry
110828947         CDS       T05136                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
zne  Zootermopsis nevadensis
Pathway
zne03030  DNA replication
zne03410  Base excision repair
zne03420  Nucleotide excision repair
zne03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:zne00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110828947
   03410 Base excision repair
    110828947
   03420 Nucleotide excision repair
    110828947
   03430 Mismatch repair
    110828947
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:zne03032]
    110828947
   03400 DNA repair and recombination proteins [BR:zne03400]
    110828947
Enzymes [BR:zne01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110828947
    6.5.1.6  DNA ligase (ATP or NAD+)
     110828947
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110828947
DNA replication proteins [BR:zne03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110828947
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110828947
DNA repair and recombination proteins [BR:zne03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110828947
   NER (nucleotide excision repair)
    Other NER factors
     110828947
   MMR (mismatch exicision repair)
    Other MMR factors
     110828947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C FERM_N_2
Motif
Other DBs
NCBI-GeneID: 110828947
NCBI-ProteinID: XP_021917857
LinkDB All DBs
Position
Unknown
AA seq 931 aa AA seqDB search
MYQRQITSFFSSAPEKSEVPSNNDSSSNDDCKEDGSEADRNVSSFKVTSSFKKKKKRRRI
LSDSEEELDASSSSSLPEKKKTSSSPVPERNSIRTHGDASEGIPSRKTASAPFRGVKQLL
PGITREVEAAKRSKTKKTKTTINGNKETEYGAVKEEEKQSLCADIEDKEMENCDEVGSKD
KKSIIKEGAGGEENQDMEGSNVKRKNKLKNSSVGGNSIQQSSSKKPIHSFFAPRKSTNAA
AQQSKTSPSSKREASLPNKSAAGKKITLKDSSEDVGTNYDPTKVKYHPIDDAFWNRGDKV
PYLALARTLEEIEGVSARLKIIEILANYFRSVIVLSPEDLLPSVYLCLNKLAPAYEGIEL
GIAETTLMKAVAQSTGRTVAQIKSDTNATGDLGVVAEQSRSNQRMMFQPAKLTVHSVFSK
LKDIAQMSGHAAMSKKVDKIQAMFVACRYSEARFLIRSLAGKLRIGLAEQSVLQALALAC
ATTPPGQLYPPEVISAAKGMSQDTFKAHVDEEALILKTTYCECPNYNMIIPILLEKGIRA
LPDHCHLTPGIPLKPMLAHPTKGVQDVLHRFENLKFTCEWKYDGERAQIHLAEGGTISIY
SRNQEDNTSKYPDIIGRLCKTLGENVTSCILDCEAVAWDKEKQQILPFQVLSTRKRKDAS
EAEIKVQVCIFMFDLLYLNGKALVREPLTKRRGLLHENFNEVEEEFMFAKSIDISAMEEV
QDFLEGSVKGNCEGLMVKTLEEDATYEIAKRSRNWLKLKKDYLEGIGDTLDVVVLGGYLG
RGKRAGTYGGFLLACYDRDNEEYQSLCRIGTGFSDEDLQKHTEFFKEHLITQPRPYYRYD
SQHEPDHWFDAVQVWEIKCADLSLSPVHRAAIGIVDPVKGISLRFPRFLRIRDDKTVEDA
TTASQVAELYGSQEQIKNQQGTGKVTEEDFY
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagagacaaattacgtcatttttctcgagtgctcctgagaagtcagaggtgcct
agtaacaatgattcgtctagtaacgatgattgcaaagaagatggatcagaggcagacaga
aatgtatcatcatttaaagtaacttcctcattcaagaagaagaagaagaggcgcagaatt
ctgagtgatagtgaagaagaattagatgcttcatccagttcatcgctgccagagaagaaa
aagacgtcttcctctcctgttcctgagaggaatagtattagaacccatggtgatgcttca
gaaggaattccatccagaaaaactgcttctgcaccatttagaggagtgaaacagctgttg
ccaggcattacaagggaagttgaggcagctaaaagatcgaaaactaaaaaaaccaaaaca
accataaatggcaataaagaaacagaatatggagctgttaaagaagaagagaaacagagc
ctgtgtgcagatattgaggacaaagaaatggaaaactgtgatgaagttggatcaaaagat
aaaaaatccatcatcaaggaaggggctggtggagaggagaaccaagacatggaaggaagt
aacgtaaagaggaagaataagttgaaaaattcgtctgttggaggcaatagcatacagcaa
tcatcatcaaagaaaccaattcacagtttttttgcacctcgcaaaagcacaaacgcagca
gcacagcaaagtaagacatcaccatcatctaagagagaagccagtctgcccaataaatca
gcagcggggaagaagataacactgaaggacagttctgaggatgttggaactaattatgac
cccacaaaagtcaaatatcatcccattgatgatgctttttggaacaggggagataaagtc
ccgtaccttgccttggctaggaccctagaggaaattgagggtgtcagtgctcgtctcaag
ataattgaaattttggcaaactattttcgctcagtgatagttctcagcccggaagacttg
ctgcccagtgtatacctctgtctcaacaaactggctccagcctatgaaggtattgaactt
ggtatagcagagacaacactgatgaaagctgttgcacagagtacaggaagaactgttgcc
caaatcaagtctgatactaatgccactggagatttgggtgttgtggctgaacagagtcgc
agtaatcagcgtatgatgttccaaccagcaaaacttactgttcatagtgttttcagcaaa
ctgaaggatattgcacagatgtcaggccatgctgcaatgagcaagaaagtggacaagatt
caagcaatgtttgtagcttgtcgatattctgaggctcgtttcctcatccgctcccttgct
ggcaaattgcgtattggtcttgctgagcagtctgttcttcaggctcttgcacttgcatgc
gctacaacacctccagggcagctttacccccctgaagttatcagtgcagctaaaggcatg
tcacaagatacatttaaagctcacgttgatgaagaagctcttatacttaagacaacttac
tgtgaatgtccaaattacaacatgataattccaatactcttagagaaaggaatcagagcc
cttcctgatcactgccacctcactcctggaattcccctgaaaccaatgttagcacatcct
actaaaggtgtgcaagatgtgctgcatcgatttgagaatctcaagtttacctgcgaatgg
aaatatgatggtgaacgtgcacagatacatcttgcagaaggtggaaccatcagtatctac
agtcgcaatcaagaagacaacactagcaaatatccagacattattggacgactttgtaag
acattgggtgaaaatgttacttcatgcatcctggactgtgaagctgtagcgtgggacaag
gagaagcaacagatcttaccattccaagttcttagcacacgtaaaaggaaggatgcaagt
gaggcagagataaaagtacaagtttgtatcttcatgtttgacctactatatttaaatggg
aaagctcttgtgcgggaacctctgaccaaaagacgtggcctgcttcatgaaaatttcaac
gaagtggaagaggaatttatgtttgccaagagtattgatatctcagccatggaggaagtc
caggacttcctagaaggatctgttaaagggaactgtgaggggctgatggtgaagacattg
gaagaagatgcaacgtatgaaattgccaagaggtcacgaaactggctgaagctaaagaag
gattaccttgaaggcattggagatacactagatgtggtggtactgggtggctacttgggt
cgtggaaaacgggcaggaacatatggaggttttctgttggcttgttatgatcgagataat
gaggagtaccaaagtttgtgcaggattggcacaggattcagtgatgaggatctacagaaa
catacagaattcttcaaggagcatttgattacacaaccacggccgtactatcgttacgac
agccagcatgaaccagatcattggtttgatgctgtccaggtttgggaaataaaatgtgct
gacttatcactttcacctgtccatcgtgctgctataggaattgtggatccagtgaaagga
atctcattacgatttccccggtttctcagaattcgggatgataaaactgttgaagatgct
accacagcatcacaggtagctgaattatatggaagccaggagcagatcaagaaccaacag
ggcactggtaaggttactgaagaggacttctattag

DBGET integrated database retrieval system