KEGG   Zootermopsis nevadensis: 110829188Help
Entry
110829188         CDS       T05136                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like isoform X1
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00480  Glutathione metabolism
zne00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110829188
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110829188
Enzymes [BR:zne01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     110829188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_N_4 GST_C Glutaredoxin SH3BGR
Motif
Other DBs
NCBI-GeneID: 110829188
NCBI-ProteinID: XP_021918362
LinkDB All DBs
Position
Unknown
AA seq 254 aa AA seqDB search
MSDKHLGKGSKNPPLSKGKLRLYSMRFDPYSQRVHLVLDAKKIPYDVVNVNLTEKPEWLY
EKSPLGKVPTLELESGDCIYESMIIADYLDEKYPQRQLYPKDPLKKAKDKLLIDQFNKVI
SNLYRLYQNMDREFLDAVMKALDVFEREIVSRSKPFFGGDKPGMLDYMIWPWCERSEMLK
IMGGDQFVLPRERFLRLMEWRNAMKEEESVKVSYLEPEIHAKYINSHRAGYADYDLLLKK
LHITVIPVSSGTVS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaacatctgggtaaaggatccaagaatccacccttgtctaaagggaagtta
agattgtacagtatgaggttcgacccctattcacagcgggtgcatttagtgcttgatgca
aaaaagataccatatgatgtagtgaatgtaaatctaacggaaaaaccagaatggctatat
gagaagagtcccctaggaaaagttccaaccttagagctggaatcaggagactgtatctat
gagagtatgatcattgcagattatcttgatgagaaatatccacaaagacaattatatcca
aaggaccctttgaagaaagcaaaagacaagcttttgattgaccagttcaataaggtcatt
tcaaatctgtacagactttatcaaaacatggatagagaattcttggatgctgttatgaag
gcactggatgtctttgagagggagatcgtttcaagatcaaagccattcttcggaggtgat
aagccaggaatgctagactacatgatttggccatggtgtgagaggtccgaaatgcttaaa
atcatgggaggagaccagtttgtgctacctagggagcgatttctaaggctgatggagtgg
agaaatgcaatgaaggaggaggagtctgtgaaagtgagttacctcgagccagaaatccat
gccaaatacatcaacagccacagagctggttatgcagactatgacctgcttcttaaaaaa
ctccacataacagtgataccagttagtagtggaacagtttcctga

DBGET integrated database retrieval system