KEGG   Zootermopsis nevadensis: 110830787Help
Entry
110830787         CDS       T05136                                 

Definition
(RefSeq) N-lysine methyltransferase KMT5A isoform X1
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110830787
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zne03036]
    110830787
Enzymes [BR:zne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110830787
Chromosome and associated proteins [BR:zne03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110830787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 110830787
NCBI-ProteinID: XP_021921758
LinkDB All DBs
Position
Unknown
AA seq 363 aa AA seqDB search
MVRGRRKYNKGRMKPITEALEDASSGVPKKKDSKLSKEFQGKLSHASPQIRTPSITKFFS
SQGYPDRKQKIKTKLGENVARETPASSVGSLTRMPCADPADSAGADDGEEKFVPQPVGCS
PHKIQLCKDITSLSPSSALSQLCISLSPKRAVKSRRRLNPSQTLNQQYAPKIVPKLNCCN
GVSVASGNHKLTEYFPVRRSVRKTKTTVLEEQQRDLEEAILSQREDGLEVVHNFEGKGRG
IVTTRLFSKGEFVVEYAGELIDICEAKEREKRYAQDQNTGCYMYYFNYRNNQYCVDATAE
SGRLGRLVNHSRSGNLITKTVPIANQPHLVLIAKDDIPAGEEVMYDYGDRSKESIRYHPW
LAS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggttcgaggcagaagaaaatataacaaaggtcgaatgaaaccaattactgaggctcta
gaagatgcatctagtggtgttcctaaaaagaaggactccaaactttcaaaagaatttcag
ggtaaactatcccatgcaagtcctcaaatcagaactccatcaattacaaaatttttctcg
tcacaaggatatcctgatcgtaagcaaaaaatcaagacaaaattgggtgagaatgttgca
agagaaacgcctgcctcgtctgtgggtagtctgaccagaatgccatgtgctgatcctgca
gactctgccggagctgatgatggtgaagagaaatttgtaccgcagccagttggctgcagc
cctcacaagatacagttgtgtaaagacatcacgtctctctctccttcaagtgctctctca
cagctgtgtatctctctgtctccaaagcgggcagtaaagtctcggcgaaggctgaaccca
agccagacgctgaaccagcagtatgcaccaaagattgtcccaaagctgaattgttgcaat
ggtgtttctgtcgcgtctggcaaccacaaattgacggagtatttcccggtacggcggagt
gtacgcaagacaaagacgacagtgctagaggagcaacagcgtgatctagaggaagcaatc
ttgtctcagagggaggatggacttgaggttgtccacaactttgagggaaaggggcgtggt
attgtaacaacaagactcttctctaaaggagagtttgtggtggagtatgcaggagagtta
attgacatatgcgaagcaaaggagcgggagaagagatatgcccaagatcagaacacgggc
tgctatatgtactattttaactaccggaacaatcaatactgtgtggatgctacagcagaa
tctggtcgtctgggacggttggtgaaccacagtaggagtggtaacctcatcaccaagaca
gtgcccattgcgaaccaacctcatctggtgctgattgcgaaggacgacatccccgcaggt
gaagaagtgatgtatgactatggggatcgcagcaaggagtccatacgctaccacccctgg
cttgcatcataa

DBGET integrated database retrieval system