KEGG   Zootermopsis nevadensis: 110830923
Entry
110830923         CDS       T05136                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00230  Purine metabolism
zne01100  Metabolic pathways
zne04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110830923
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110830923
Enzymes [BR:zne01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110830923
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 110830923
NCBI-ProteinID: XP_021922033
LinkDB
Position
Unknown
AA seq 1136 aa
MAASVAEKESGSGGDLVGQPLLQTAPFRFLQRSFRDPALEKLYQSYSVKQKRAGLEVFLY
AAILYDVYMLVVPGGQDALMRGLTIAFLGLNLGLLAWCCRGVQHSSVWAAVPHLAWHLAN
SQLLAHLFLKKNEVTGRDSLGWVLLLDYLLFVTLPLRLRYCVVLSAGTCASYLVAIVGLG
KSDAHLLQQVIANCLLLLTANLLGLTSCYLADNQQRRAFLETRQSLEMKLVIEEQSAEQE
RLLLSVLPEHVAVKMRQDLGSSKDSQFKKIYMSRHENVSILYADIVGFTAISSTYSASEL
VKILNELFARFDRLSERYQQLRIKILGDCYYCISGAPRERPDHAVLCVHMGLSMVKAIKY
VQQKTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGLPGRVHISEKT
LSYLNGEFEVEAALGEKREETLRMAGIKTFFIVKALKPFHPATPDVRNGKVTEEETASCD
ATPDNKDSDDDSACASPVDDSHVLSNGRAREDSADFKKRLRKELVNRDGHRDLMNHTTFF
TLSFKDRETEREYNLHKESFSSISVMGCPLVLLITSAAQFVVLPRDLMNILSFTVGFLLL
VILSAMIVAEFFPSSFPRPMVRCSEALNNSLWTRRVIGVVVIALLGVTNIVDMVSCTVPS
SPSNYTTTTEDLGSVCLYPSYFSYFCVLVLIAASLPAQVSHLVKAGLLFLIATAHCCMNV
FAIGPALDCEEATNHRDWGNIAPGKYALCGLLLAVTIALAFLARHLEKASRVLFLWKTEV
EDQRERASDIRRRNEALVYNILPPHVAAHFMGSRKRQHEELYSQSYAEVGVLFASMPNFS
DFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGLNPSRQV
KPDDPIKVRWSHLALLVEFALELKKALQGINEQSFNHFVLKMGINHGPITAGVIGARKPH
YDIWGNSVNVASRMESTGKAGCIQVTDETTEILKHFGYIFEQRGLVSVKGKGQLMTYYLI
GKGSNPESTLRSKEETKNNPETNLKLNEDFKINLETNEDFSNSPEHEIIPVQHSSGGNLN
WVEESEQRNPGHNLDLSDDPKHQLSSEDTSPLILSSTAVISGSGETHLLQKSDVDD
NT seq 3411 nt   +upstreamnt  +downstreamnt
atggcggcgtcggtggcggaaaaagaaagtggttcgggtggcgacttggttggccagccg
ttgcttcagactgccccgtttcgtttccttcagcggtcatttagagaccccgccctggag
aaactgtatcagtcctacagcgtgaaacaaaagcgtgctggattggaggttttcctttac
gccgctatcttgtatgatgtgtacatgttggtggtgccgggtggacaggacgccctcatg
cgtgggctaaccatcgcttttcttggcctgaacctcggactcctcgcttggtgctgtcgc
ggagtccagcactcttcggtatgggccgccgttccccatcttgcctggcatctcgccaac
tctcaactactcgcgcacttgttcctcaagaaaaacgaggtcacgggcagggattctctg
ggctgggtcttgttacttgactatctgctcttcgtgacactaccactgagactccgctac
tgtgtggtgcttagtgcgggcacgtgtgcttcttacctcgtggctattgtgggcctcggg
aagtcggacgctcatctcctccaacaggtaatagcgaactgtctcctgcttctcaccgct
aacttgctgggcctcacatcatgttacctggcggacaatcagcaacgcagagcgttccta
gaaacccgtcagtctctcgagatgaagctcgtcatcgaggagcagtctgcagaacaggaa
aggttattgctgtcagtactgccagagcatgtggctgtcaagatgaggcaagatcttggg
tcctccaaggacagtcagttcaagaaaatctacatgagtcgccacgaaaacgtcagtatc
ctgtacgcagatatcgtgggttttaccgccatatcttcaacgtactctgcctctgagctg
gtcaagatactcaacgagctttttgcaagatttgacagattatcagagcgctaccagcag
ctgaggatcaagattctgggtgactgttactactgtatcagcggggctccacgagaaaga
ccagaccacgctgtgctctgtgtccatatgggactctctatggtcaaggctataaaatac
gtgcagcagaagacgaactcccccgtggacatgcgagtggggatacacacgggggccgtg
ctggcaggagttctgggccaaagacaatggcagttcgacgtctactccaaagatgtggaa
ctggcgaacaagatggaaagcagtggcctgcctgggcgtgtacacatctccgagaagaca
ctgagttatctcaacggagaattcgaagtggaggctgcactgggtgagaaacgtgaagag
acactacgtatggctgggataaaaaccttcttcatcgtaaaggctctgaaaccgttccat
ccagcaacgccggacgtccgtaacggcaaagtgacggaggaggagacggccagttgcgac
gcgacgcccgacaacaaggacagcgatgacgactccgcgtgcgcaagcccagtggatgac
agtcatgtactgagtaacggacgagcccgagaagactcagcggacttcaaaaagcgtcta
aggaaggaacttgtgaacagagatggacacagggacctgatgaaccacactacgttcttc
actttgtcgttcaaagacagggaaacagaacgcgaatataacttgcacaaggaatcgttt
tctagtatctctgtgatgggttgtcctctggtactcctcattacatcagccgcacaattt
gtcgtgttgcctagggatctgatgaacatcctgtcgttcacagtcggttttctactccta
gttattctatcggcaatgattgtggctgagtttttcccttcgtcattccctcgacctatg
gtgcgttgcagtgaggctctgaacaattccttgtggacaaggagggtcattggtgtcgtt
gtaattgcgctcctaggggttaccaatattgtggatatggtgtcttgcacggtcccttcg
tctcctagcaactacaccacgacgacagaggacctgggcagcgtgtgcttgtatccctcg
tacttctcgtatttctgcgtcctggtactgatcgcggcgtccctgcccgctcaagtgtcc
catctcgtgaaggccggtctgttgttcctaattgcaacagctcactgctgcatgaatgtc
ttcgcgatcggcccggcacttgactgcgaggaggcgaccaatcacagagactggggaaac
attgcgcctggaaagtatgcattatgtggtctcctcctggctgttactatagccctggca
ttccttgcccgccatttagagaaagcatcccgagtgctgttcctatggaagacggaagtg
gaggatcagcgggagagagcgtctgacatcagacgccgcaacgaggccctagtgtataac
atcctgccaccgcacgttgcagctcattttatgggcagtcgcaagagacagcatgaagaa
ctgtacagtcagagctatgctgaagtcggggttctgtttgcctcaatgcctaacttctca
gacttttattcagaggagacagtgaacaatcaaggcctggaatgtttacgatttctgaat
gaagtcatctccgattttgatgctttactggaactacctcagtttcaggatataatcaag
attaaaaccatagggtctacatacatggctgcaagtggactcaacccatctcgacaggtc
aagcctgatgatcccataaaagttcgttggtctcatcttgcactcctagtggaatttgct
ctggaactcaagaaggcactccaaggcataaatgagcagagcttcaaccatttcgtgctc
aaaatgggaataaaccatggaccaatcacagccggtgtgatcggtgcacgaaaaccacac
tacgatatctggggcaactctgtcaatgtagcatcacgaatggaaagcaccgggaaggca
ggatgcatacaggtaactgatgaaactactgaaattctcaagcattttggatacattttt
gaacagcgtggattggtctcagtgaagggaaaaggacagcttatgacgtactatctcatt
ggtaaaggatctaatccggaatcaaccttaaggagcaaagaagaaaccaaaaataaccct
gaaactaacctgaaattaaatgaagacttcaaaatcaatctcgaaacaaatgaagatttt
tctaacagcccagaacatgaaattattccagtacaacacagttctggaggtaacctgaac
tgggtggaagaatctgaacagcggaaccccggacacaacctagacctgtctgatgatccc
aaacaccagctgtcgtctgaagacacatcaccgctaatactaagttccactgctgtcatc
tctgggtcaggtgaaacgcatctactacagaaatcagacgtagatgactga

DBGET integrated database retrieval system