KEGG   Zootermopsis nevadensis: 110831106Help
Entry
110831106         CDS       T05136                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00562  Inositol phosphate metabolism
zne01100  Metabolic pathways
zne04068  FoxO signaling pathway
zne04070  Phosphatidylinositol signaling system
zne04140  Autophagy - animal
zne04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110831106
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110831106
   04070 Phosphatidylinositol signaling system
    110831106
   04150 mTOR signaling pathway
    110831106
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110831106
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:zne01009]
    110831106
Enzymes [BR:zne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110831106
    3.1.3.48  protein-tyrosine-phosphatase
     110831106
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     110831106
Protein phosphatases and associated proteins [BR:zne01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    110831106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 110831106
NCBI-ProteinID: XP_021922411
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MGLCFSCRKSRLNSVKSEYFSASATPLHVCVEEQRGPELGSSSKEICQYTGYIKMANTMS
NMKMTNPIKGLVSKRRKRYTQDGFNLDLTCILCLHFPVTFFLQLLYRNHIDDVVKFLEAK
HKDHYKIYNLCSERSYDVAKFQQRVANYPFDDHNPPKMELIGPFCTDVHNWLSQDHRNVA
AVHCKAGKGRTGVMVCCYMLHSKQFPTANEALNYYGQMRTLDTKGVTIPSQRRYVGYYAS
LLQEQLNYHPVTLLIKEIHLEPMPTINGGQACLQLVISESSTKVFSSPVYEVKKGSPSFH
ICLEQYIPLQGDIKVEFFNKPKMMRREKMFHFWFNTFFVREEVQVPEASVNGNEDMDMMP
PERSSRAMSCDEQSHVPPLNIRQPRTGSLVSLEPNMKMLVLQLDKWGLDDAHKDKQNKVY
TSDFKVSLFLHRVPTELGSVPPMEQCWSRSRQATKFQETPSESSGNDSSESDTAEEEEEE
DGWESVDSAERRVGRYRLLSDPDFRHSGQLFQS
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggggttatgcttttcttgcagaaagtctagactgaacagtgtaaagtctgaatatttt
tctgcatcagcaacaccactccatgtttgtgttgaggagcaaagaggaccagaattgggt
tcatcttctaaagaaatttgccagtacacaggttacataaagatggcaaacactatgtca
aacatgaaaatgaccaatcctattaaaggtcttgtcagtaagagacgaaaaagatacacc
caagatggattcaatttggatcttacatgtatcctttgtttacactttccagttacattt
ttcttgcaattattatataggaatcatattgatgatgttgtaaaattcttggaagctaaa
cataaagaccattacaaaatttataatttgtgttcagagcgttcatatgacgtagcaaaa
ttccagcagcgtgttgccaattacccatttgatgatcacaaccctccaaagatggaactt
attggaccattttgtacagatgtccacaattggctgtcacaggaccacaggaatgttgca
gcagttcactgtaaagcaggaaagggtcgtactggcgtgatggtatgttgttatatgtta
catagtaagcagtttccaacagccaatgaggcactcaactattatggtcagatgaggacc
cttgatacgaagggtgtgaccatacccagccagcggcgttacgtaggttattatgcatct
ttattacaagaacaattaaactaccatccagtgacacttctcatcaaagaaattcaccta
gaacccatgccaactattaatggaggacaggcttgccttcagttagtgatctctgagtcg
agtacaaaagtgttctcatcgccagtatatgaagtgaagaagggttctccttcttttcac
atttgcttggagcagtatatccctttgcaaggtgatatcaaggtggagttcttcaataaa
cccaagatgatgcggagagagaagatgtttcatttttggttcaatacattctttgttcgt
gaagaagtacaagtacctgaggcttctgtgaacggaaatgaggacatggatatgatgcct
cctgaacgttctagccgagccatgagctgtgacgaacaatcccatgtgccacctcttaac
attcggcaaccaagaactggttctcttgtgtcgctagagccaaacatgaagatgttggtg
ctacagcttgataaatggggacttgatgatgcccataaagataagcagaataaggtttac
acctcagattttaaggtgagtttgttccttcaccgagttcccacagaattgggttcggtc
cctccaatggagcagtgctggtcacgtagcaggcaggctaccaagttccaagaaacacca
agtgaatcatcaggaaatgattcaagtgagtctgatacagccgaagaggaagaagaggag
gatggttgggagtcagtggattctgcagagcgaagggtgggcagataccgtctcctgtcc
gatcctgacttcaggcattcaggccaactctttcagtcgtga

DBGET integrated database retrieval system