KEGG   Zootermopsis nevadensis: 110832081
Entry
110832081         CDS       T05136                                 

Definition
(RefSeq) uncharacterized protein LOC110832081
  KO
K16679  wengen
Organism
zne  Zootermopsis nevadensis
Pathway
zne04013  MAPK signaling pathway - fly
zne04214  Apoptosis - fly
zne04215  Apoptosis - multiple species
zne04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:zne00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    110832081
   04391 Hippo signaling pathway - fly
    110832081
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110832081
   04215 Apoptosis - multiple species
    110832081
SSDB
Motif
Pfam: TNFR_c6 FtsL
Other DBs
NCBI-GeneID: 110832081
NCBI-ProteinID: XP_021924428
LinkDB
Position
Unknown
AA seq 460 aa
MKMITERILHSSKVMVWWLLLLPLGVAALCRPGHQFWDETSERCVNCSKCPVAGHVVLRP
CQVHQDTQCGPLSALDIDWSFLNRPRSSKATSVSRHQHLSAKHHEVFAEEHFSDSAVAED
VRSSRNHPQGEGTSTHVVKHKEKNSHPKFVSSEGIKARNHKKSHHIKLSTEESYSEHRDE
SPRHHKHHHYHEEHASSERRCSNPRKLRNHNQNRTKSQQHSRQKCKWTSSETVHSFDSEP
RRVDGRRWSFSESASSAERHASSSRKSNDTMKHHHHHHKHTDEHREKKLEGVQDEAGGMP
VRRPESASQLRESEEAVVNSSLDGGLLPRRVSQSVVSAPFSSAEELVWDWQAVAMALAVF
ACLLFFAVACVYSVHHARQWRRLKDHFEDFEADVGELSTRLSLLLPAVRPEEEAVQAECC
NSSSQCVYLEQLLARKQQSEEGAGNGNVYIDREVVAGHRE
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaagatgattacagaacggattttgcattcatccaaggtgatggtctggtggttgcta
cttcttccactgggcgtcgccgcactatgtcgcccaggacaccagttttgggacgagacg
tcagagagatgtgtgaactgcagtaaatgcccagtcgctggacatgtcgtcttacgacca
tgccaagtccatcaggacacccagtgcgggccgttatcagcactcgacatcgactggtcg
ttcctgaacagaccgcgctcctcgaaagccaccagcgtctcacgccatcagcatttgtca
gcgaagcaccacgaagtgttcgccgaagagcatttcagtgacagcgctgttgccgaagat
gtacgatcatctcgcaaccacccccagggcgaggggacgtcgacgcacgtcgtaaaacac
aaagagaaaaattcgcatccaaaatttgtttcttccgaaggaataaaagcgagaaaccac
aaaaagtctcatcatataaagttgtccacagaagaatcgtattcagaacatcgagatgaa
tcacccagacatcacaaacatcaccactatcacgaggaacatgcctcctcagaaagacgt
tgctcaaatcctagaaaactccggaatcataatcagaacagaaccaaaagccaacagcac
agccgacagaaatgtaagtggacgtcttcagagacggtccattcgtttgactctgagccg
cgccgcgtggatggacgccgatggtcgttctccgagtcagcgagttcagctgagcgtcac
gcgtcctcttccagaaagtcgaacgacacgatgaaacatcatcatcatcatcacaagcac
acggacgaacaccgcgaaaagaaacttgaaggcgtccaggacgaagctggaggaatgcca
gtgcggcggccagaatccgcctctcagttaagagagtccgaggaggccgttgtcaactcg
tcgcttgacggcggtctgctccccaggcgcgtcagccagtccgtggtctccgccccgttc
tcttcggccgaggaactggtctgggactggcaggccgtcgcaatggccctcgcggtcttc
gcctgtcttctgttcttcgccgtcgcctgcgtgtactcggtccaccacgcgcggcagtgg
aggaggctcaaggaccacttcgaggacttcgaagcagatgtgggagaactgtcaacacga
ctcagccttttgctgccagcagtccgtcctgaagaagaagctgttcaggccgaatgctgc
aacagttccagtcagtgcgtctatctggagcagctgctggcgcgcaaacagcaatcagaa
gaaggagcaggaaacgggaacgtgtacattgatcgggaagtcgtggctggccatcgagag
tga

DBGET integrated database retrieval system