KEGG   Zootermopsis nevadensis: 110832859Help
Entry
110832859         CDS       T05136                                 

Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
zne  Zootermopsis nevadensis
Brite
KEGG Orthology (KO) [BR:zne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zne03036]
    110832859
Enzymes [BR:zne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110832859
Chromosome and associated proteins [BR:zne03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     110832859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 110832859
NCBI-ProteinID: XP_021925963
LinkDB All DBs
Position
Unknown
AA seq 1112 aa AA seqDB search
MSSQANDSSGSDAYSRFSCTTNPVLQHVPMGSGRYDFECLSHTRPKIRRVIGSRTSCLVS
STIKTSYNKDVGSYRNVEISSAFSHLPQKDMARDSPVGSPVVSRRNDLNNLNNTYHIDPG
LHEQAFQQQILQLKKQQQLQQQILLQHFQAQQAQLAEQHEQQLQQHLKFWEQQKQLEEQR
ERREKEKLEALKKKDKHEHSAVASNEVKRKLMDFLQKKQEAAAAAASNGTLPVSSPSGYR
NWSVLQAPQGSDASSSAANINPAAGVAHPYRLQPMMPKYDDDFPLRKTASEPNLLKVRLK
QRMTSHRNSPMARRKDRLLATQKRKSQLAIDTSNSNPDSGPNSPPSVANAQASPTAGRNT
PIQEEGEVSPYGPLASSSHQGSMSDLSLYSSPSMPNISLGRPPIHSSEGAKLAPVSEAEV
RAAFTARLGMPLTGQMLPGTLPFYPTLPVIDGEYSNPNSPGYIHKQMQSLEQARPGNLLP
SVYQGAPITDTQVAHARLNKQGHRPLGRTQSAPLPLGHPMLAGSSIAIVPTHYEEYLPEK
QVYDQQQAHNFLKQQIRQTVLTRAGSRGQSSGGQLDEAPETEETAEVIDLTDRKGSEESE
ISKQQRDREQFLQQQRDLMMRHTLQVSEGKLLLLYVPRSSHIARPLSRXXXXSCVPVNNH
CSSKVGGSGPHRLTTGLAFDSLMLKHACICGDNSSHPEHGGRLQSVWARLMETGLVQRCD
RVRSRKATLEEIQACHSEAHALLFGTNPLNRQKLDVSKLSQLPIKSFVRLPCGGIGVDSD
TTWNELHTAPAARMAVGCVVDLAFKAATGDIKNGFAVVRPPGHHAEASQAMGFCFFNSIA
IAARLLQQRLDVQRILIVDWDVHHGNGTQQMFYDDPRVLYLSIHRHDDGNFFPGTGGPTE
CGVGEGVGFNVNLAWSGGLAPPMGDAEYLAAFRTVVLPIAKEFAPDIVLVSAGFDAAAGH
AAPLGGYKVSPACFGHMTQQLLKLADGKVILSLEGGYDLPSICDSAQECVRALLGDEPSP
LREEELRRLPCQNAIDTLQKTIAIQLPHWPCIKRTAHTAVCSAVEAIQKEKDETETVTAM
ASLSMQQQSNSLQTPEHSRDSSEEPMEQDDAK
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccaggccaacgacagctcaggctctgacgcctacagccgtttctcatgcacc
actaatcctgttctgcaacacgtgccaatgggaagcggtcgatacgattttgaatgcctg
tcacacacacgtcccaagattcgtcgcgtgattggttctcgtaccagttgcttggtaagt
tctaccatcaagacgagttacaacaaagacgtggggtcataccggaatgtggaaatcagt
tcagccttctcccatctgccacaaaaagatatggcgagggactcccctgtaggcagtcct
gtcgtgtctaggagaaacgatctcaataatctcaacaacacgtaccacattgatcctggc
ctgcacgagcaggcatttcaacagcagatcctgcagttgaagaagcagcagcagttgcag
cagcagattctactgcaacactttcaagcgcagcaggcacaactcgcagaacaacatgaa
caacagctgcagcaacatctcaagttctgggaacagcagaagcagttggaagaacagcgt
gaacgacgtgagaaagagaaactggaggccctcaagaaaaaagataaacacgaacacagt
gctgtcgcttccaatgaagttaagcggaagttgatggatttcctgcagaagaaacaggaa
gctgcagctgctgctgcttctaatggaacactgcctgtcagttctccctctggatacagg
aactggagtgtactacaagctccgcaagggagtgatgcaagttcctctgcagcaaatatc
aacccagctgcgggagttgcgcacccatatcggctgcagcccatgatgcccaaatatgat
gatgactttccactcaggaaaactgcctccgagccaaacctcctgaaggtacgcctcaag
caaagaatgaccagccatcgcaatagtcccatggccaggcgcaaagatcgcctcctcgcc
acacagaagaggaagtcgcaactagcaattgacacatcaaatagcaatccagattcaggc
cccaattccccgcccagtgttgccaatgctcaagcttccccaactgcaggcagaaataca
cccatacaggaggaaggtgaagtttcaccatatggaccactggccagcagtagtcatcaa
ggcagtatgagtgacctgtctttgtacagcagtccttctatgccgaacatctccctaggt
cggccacccatccattcatcagaaggagcaaaacttgcaccagtctcagaagctgaagta
cgagccgcatttacagctcgattgggcatgcctcttacaggacaaatgttgcctggaact
cttcctttctatcctactctaccagttattgatggtgagtacagcaaccccaactctcct
ggttacattcataagcaaatgcagtctctggaacaagcacgaccaggaaacttgctgcca
agtgtgtaccagggtgctccaatcacagatactcaggtggcacatgcaagattgaacaag
caaggtcatcgccctctggggcgtacgcagtcagctccgctacctctgggacatcccatg
ttggcaggaagtagcattgccattgttcccactcattatgaggagtaccttccagagaag
caggtttatgaccagcagcaggctcacaatttcctcaagcagcaaattcggcaaacagtg
ttgactagggctggaagtagaggccagtcaagtggaggtcagttggatgaagctccagaa
actgaggagacagctgaggtcatagatctgacagatagaaaagggagtgaggagagcgag
atctcaaaacagcaacgagaccgagagcaattcttgcagcaacagcgagacttgatgatg
agacacacacttcaagtcagtgaaggtaagcttctattactgtatgttccaaggtcatcg
catatagcaagacctctctcacgnnnnnnnnnnnnntcttgtgtcccagtcaacaatcac
tgcagcagtaaagtgggtggatctggaccacacagactcacaacaggattggcatttgat
agcctgatgctgaaacatgcatgcatctgtggtgataattcaagtcacccagaacatggt
ggaaggcttcagagtgtgtgggctcgtctcatggaaacaggcttggtacagagatgtgat
cgtgtgagatccagaaaagctaccttggaagagatacaagcttgccatagtgaagcacat
gctctgctgtttggtacaaatccactgaaccgccagaagttagacgtgagcaaactgtca
cagcttcccattaagagctttgttcgtctgccttgtggtggtattggtgtagattcagac
acaacgtggaatgaactgcacaccgcaccagctgctcgaatggctgttggctgtgttgtt
gatttagcattcaaagctgctacaggagatataaagaatggatttgctgtagttcggcca
cctgggcatcacgctgaggcctctcaggcaatgggcttctgttttttcaattcaattgct
attgcagcccgtcttctgcagcagagactggacgtccagaggattctcattgttgattgg
gatgtgcaccatggcaatggaacccagcagatgttttatgatgatccaagagtattgtat
ctctctattcatcgtcatgatgatggtaactttttcccaggtactggaggaccaacagag
tgtggtgttggtgaaggagttggtttcaatgtgaatctggcatggtctggtggccttgct
ccgcctatgggagatgcagagtacttggcagctttcaggactgttgtcctgcctattgca
aaagaatttgcaccagatattgttctggtgtctgccggttttgatgcagctgctggccat
gctgcaccccttggaggttacaaggtgtcacctgcatgttttggtcacatgacacaacag
cttctcaagttagctgatggaaaggtgatcttgtcactggaaggcgggtatgatcttccg
tccatctgtgattcagctcaagaatgtgtccgtgctttacttggagatgaacccagtcct
ttgcgggaggaagagttgaggcggttgccgtgtcagaatgctattgatacattacagaaa
acaattgccattcaacttccgcattggccatgcattaagcgtactgcacacacagccgtc
tgttcagctgtagaagctatacagaaggagaaagatgagacagagacagtaactgcaatg
gctagtctgtcaatgcagcagcaaagcaacagtttacaaacacctgagcattcccgagac
tcatcagaagaaccaatggaacaggacgatgctaagtga

DBGET integrated database retrieval system