KEGG   Zootermopsis nevadensis: 110834052Help
Entry
110834052         CDS       T05136                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00052  Galactose metabolism
zne00500  Starch and sucrose metabolism
zne01100  Metabolic pathways
zne04142  Lysosome
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110834052
   00500 Starch and sucrose metabolism
    110834052
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110834052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zne04147]
    110834052
Enzymes [BR:zne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110834052
Exosome [BR:zne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110834052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110 Tmp39
Motif
Other DBs
NCBI-GeneID: 110834052
NCBI-ProteinID: XP_021928525
LinkDB All DBs
Position
Unknown
AA seq 1034 aa AA seqDB search
MQGPIKSVLRRITTLGSVRADETQPIESSFNEQKMNEDTNSVTKETSGPEFNRLNVRYSS
TTKLTPDDSRCPRPSVSTFLILSLVIILVIVIPIINLNSQWPSDEFNRVITDHSHSNPRK
EIVQEREKTVVFHNIMRQVVEKVAHNNSMFSSHIIRPSTSVTTKQCEQISDEFKFDCYPE
DGATESRCKARGCCWVSRNKKLLNKDSVENSRVHHASLNVPYCFYPSGYGGYKFINITET
PSGSISFLKRTFKSPYPGDVAVIRMDIRYETEQRLRIKIVDPLHSRFEPPYPEVPVMEHN
LPTMDYQVQLDKTKTGFKVVRKSDSVAVFDAQDVGAFIFADQFLQLSAFLPSDYIYGLGE
HRSTLLLSTHWQRFTMFNHDHVPEENTNLYGSHPFYLVMEKSEKSHGVFLLNSNAMEVIL
QPAPAITFRTVGGLLDFFIFLGPSPQNVIQQYTEVIGRPYMPPYWGLGFHLCRFGYNSLN
NTREVWMRTREAGIPLDVQWNDLDYMNNSNDFTYDREKFKYLPEFVEELHELGMHYILLI
DPGVSGSEKPGTYPPYDEGLQMDIFIKNTSGQPFVGKVWNRVSTVWPDFTHPRTVDYWLR
QLKRLHQEVPFDGAWIDMNEPSNFLSGSTKGCPDNNLEHPPYFPAGVNGGRLFYNTLCMS
STQYAGRHYDIHNLYGFTEAIVTSFVMTEIREKRPFVISRSTFAGHGLYAGHWSGDISSS
WYDMKKTIPQLLNFNLFGIPLMGADICGFNRNTTAALCQRWSQLGAFYPFSRNHNTDDGI
PQDPVALGPAVVQSARKSLLVRYSLLPYLYTLFWRAHVHGDTVVRPLFFEFPSDVHTYSI
DEQFLWGSALMIVPVLEEDKTEVSAYLPHALWYDFYTLAVVPGSGTQHTLSAPLDTIPLL
IRGGSIIPTQAPNMTTTESRKNDFELLIAPDKDGRATGSLYWDDGDSLNTYADRRYNFLN
FTLAKSHLTGSTIWWEYSAMPVLDKVTVLGIQKPVKSVFVNQASKPFSYHTMNKFMKVEN
LKLRLNNSFSIHWI
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaccaataaaaagtgttcttagaagaatcacgactcttggaagtgtcagggca
gatgaaactcaacccattgaatcaagcttcaatgagcagaaaatgaatgaagatacaaat
tctgttactaaagaaacatccggaccagaatttaacagactgaatgtacgttactcttct
acaacgaaacttactcctgatgactcaagatgtccccgccctagtgtttcaacattttta
atattatcattggtaatcattctggtcatcgttatccctattataaatctgaattctcag
tggccatcagacgaatttaatcgtgttatcacagatcatagccactctaatccaagaaaa
gaaattgtacaagaaagggaaaaaacagtagtttttcataacataatgagacaagttgta
gaaaaagtggcgcacaataacagtatgttttccagccatatcattcgtccatcaacaagt
gttacaaccaagcaatgtgaacaaatttctgatgaatttaaatttgattgttatccagaa
gatggagcaactgagtcacgttgtaaggcaagaggatgttgttgggtctccagaaataag
aaactgttgaataaggattctgttgaaaacagtagggtacatcacgcgtccttaaatgtt
ccatactgcttttatccttctggttatggtggctataaattcatcaatataactgaaaca
ccatcaggctcaatttcattccttaaaaggacattcaagtcaccataccctggtgatgta
gcagtgattaggatggatattagatatgaaacagaacagcggcttcgtataaagattgta
gatccacttcacagccggtttgaacctccatatcctgaggttccagtaatggaacataat
ttacccactatggactatcaggtgcaacttgacaagaccaaaacaggctttaaagttgtg
aggaaaagtgacagtgtggcagtttttgatgcacaagatgtgggagcatttatatttgct
gaccaattcttgcagttatcagcttttctgccctctgactacatatatggccttggagaa
catagatctacattgctgctgtccacacactggcaaagattcacaatgtttaaccatgac
catgtacctgaagaaaatacaaatctctatggcagtcatcctttttatctggtaatggag
aaaagtgaaaagagccatggtgtgtttcttctcaatagcaatgctatggaggtgatcctt
caaccagcaccagccatcacatttcgaactgtgggagggctcctagacttcttcattttc
ttaggccccagtccacagaatgttatacagcaatatacagaagtaattggaagaccatac
atgcctccttactggggattaggattccatctttgcaggtttggttacaacagcttgaat
aacacacgggaagtttggatgaggactcgggaagcagggattccactggatgtgcaatgg
aatgatctcgactacatgaacaactccaatgattttacatatgacagagagaagttcaag
tatttacctgagtttgtggaagaattacatgagctggggatgcattacattctactaata
gatccaggagttagtggaagcgaaaagccaggcacttatccaccttatgatgaaggcctt
caaatggacatcttcattaaaaataccagtggacaaccatttgttggaaaggtatggaat
cgtgtctctacagtgtggccagacttcacacatcctcgcactgttgactactggctgcga
cagttgaaaagacttcatcaggaagttccatttgatggagcatggattgatatgaatgaa
ccatccaactttttgtctggcagtaccaagggctgtccagataacaatctagaacatcca
ccatattttccagcaggagtgaatggtggcaggctgttttataatacactgtgtatgtca
agcacccaatatgcagggcgccattatgatatacacaatctctatggctttactgaagca
attgttacaagttttgttatgacagaaattagagagaaacgcccttttgtgatctctcgt
tcaacatttgctggtcatgggctatatgctggtcattggagtggtgacatatcatcatca
tggtatgatatgaagaagaccattccacaacttctgaacttcaatttatttggaattcca
ctaatgggtgcagacatatgtggattcaataggaacacaactgcagcactctgtcagcgt
tggagtcaactgggtgcattttatccattttctcgcaatcataacacagatgatggcatt
ccacaagatccagtggcattgggacctgcagtggtgcagtcagctcgcaagtctctgctg
gtgcgttactcactgctgccatatctgtacaccctcttctggagggctcatgtgcatgga
gatactgttgtgcgacctttgttctttgagttcccatcagatgttcacacttacagcatt
gatgagcagtttctgtggggttcagctctcatgatagtacctgtcctggaagaggataag
acagaggtgtcagcctatcttccacatgcattgtggtatgacttctacacattggctgta
gtaccaggtagtggtacacagcatactctatctgcaccactggacaccatccctctacta
atacgaggtggcagtatcattccaacacaggctcccaacatgacaaccacagaaagtcgg
aaaaatgattttgagctgctgatagccccagataaggatggccgtgccactggctctttg
tactgggatgatggtgattcactcaatacgtatgcagatcgacggtacaactttctgaac
tttaccttggctaagtcacatctcacaggatctacaatttggtgggaatatagtgccatg
ccagttttagataaggtcacagtccttggaatacagaagccagtgaagtctgtatttgtg
aaccaggcttctaaaccattctcttaccacaccatgaacaagtttatgaaggttgagaac
ttgaaacttcgtctgaacaactcgttctctatccactggatataa

DBGET integrated database retrieval system